(data stored in ACNUC7421 zone)

EMBL: AP009493.PE459

AP009493.PE459       Location/Qualifiers
FT   CDS_pept        complement(540933..542024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_459"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17288"
FT                   /db_xref="GOA:B1VQI7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI7"
FT                   /protein_id="BAG17288.1"
FT                   /translation="MVRTVGVEEELLLVDEVSGEARALSSAVLAIAEKEADGESAFESE
FT                   LHRQQVEFSTHPCASMEELAASVRRWRTEAVRHATEAGASVAALATSPLPVSPTIGTGE
FT                   RYRWLAERFGLTAQEQLTCGCHVHVSVASEEEGVAVLDRIRPWLPVLLALSANSPFWQG
FT                   QDSRYSSYRGQVWGRWPSAGPADVHGSAEAYHAQVRSLVATGVLRDEGMVYFDARLSHR
FT                   YPTVEVRIADVCLDPADTVLLATLVRGLVETAARAWRAGEPPGDVSTSLLRVASWQAGR
FT                   WGLEDRLVHPRTLCPEPASEVLRALLDQVREALEDSGDLADAERALAEVLRRGNGARIQ
FT                   REILARTGSLRDTVAECVRISAG"
     gtggttcgaa cggtgggtgt ggaggaagaa ctgctgttgg tcgacgaggt gagcggagag        60
     gcccgcgccc tgtcctcggc ggtgctggcg atcgccgaga aggaagcgga cggtgagtcg       120
     gccttcgagt ccgaattgca ccgccagcag gtggagttct ccacccatcc ctgcgcgagc       180
     atggaggaac tcgccgcctc ggtccgccgg tggcgcaccg aggcggtacg gcacgccacc       240
     gaggccggcg cctcggtggc ggccctggcg acctcgccgc ttccggtcag cccgaccatc       300
     ggcacggggg agcggtaccg gtggctggcc gagcgcttcg ggctgaccgc ccaggaacag       360
     ctgacctgcg gctgccacgt ccatgtctcg gtggcctccg aggaggaggg cgtcgccgtg       420
     ctcgaccgga tacgcccctg gctgccggtc ctgctcgccc tgagcgccaa ttcaccgttc       480
     tggcagggac aggacagccg gtacagcagc taccgcggcc aggtgtgggg gcgctggccg       540
     tccgccggcc cggcggacgt gcacggctcc gcggaggcgt accacgccca ggtgcggtcc       600
     ctggtcgcca ccggggtgct ccgcgacgag gggatggtct acttcgacgc gcgcctctcg       660
     caccgctacc ccaccgtgga ggtgaggatc gcggacgtct gcctggatcc ggccgacacc       720
     gtgctgctgg ccacgctggt acggggactg gtggaaacgg ccgcacgcgc gtggcgggcc       780
     ggtgagccgc ccggggacgt cagcacgtcc ctgctgcggg tggcctcctg gcaggcgggc       840
     cgttggggcc tggaggaccg gctggtccat ccgcgcaccc tgtgcccgga gccggcctcc       900
     gaggtgctgc gtgccctgct ggaccaggtg cgcgaagcgc tggaggacag cggggacctg       960
     gcggacgcgg agcgggccct ggccgaggtg ctccgacgcg ggaacggggc acggatccag      1020
     cgcgagatcc tggcgcggac cgggagcctg cgcgacaccg tcgccgaatg cgtccggatc      1080
     tcggcgggat ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page