(data stored in ACNUC7421 zone)

EMBL: AP009493.PE460

AP009493.PE460       Location/Qualifiers
FT   CDS_pept        complement(542055..542282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17289"
FT                   /db_xref="InterPro:IPR033457"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI8"
FT                   /protein_id="BAG17289.1"
FT                   /translation="MLMAHPTVLRNLIDQYEALRVLHAESGSEEARRRMDDVAYTLCVS
FT                   TGTADVDSALVAARHRLPGARPEDDSVLTA"
     atgctgatgg cccaccccac ggtgctgcgc aatctgatcg accagtacga ggcactgcgt        60
     gtgctgcacg cggagagcgg cagcgaggag gcgcggcggc gcatggacga cgtggcgtac       120
     acgctgtgcg tgtcgaccgg cacggccgac gtcgacagcg cgctcgtcgc ggcccgccac       180
     cggttgcccg gcgcccggcc cgaagacgac tccgtcctga ccgcctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page