(data stored in ACNUC7421 zone)

EMBL: AP009493.PE462

AP009493.PE462       Location/Qualifiers
FT   CDS_pept        complement(543346..543549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_462"
FT                   /product="putative cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_462"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17291"
FT                   /db_xref="GOA:B1VQJ0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ0"
FT                   /protein_id="BAG17291.1"
FT                   /translation="MASGTVKWFNSEKGFGFIAQDGGGPDVFAHYSNINSTGFRELQEG
FT                   QAVTFDITQGQKGPQAENITTA"
     atggccagcg gaaccgtcaa gtggttcaac tcggaaaagg gcttcggctt catcgcgcag        60
     gacggcggcg gtcccgacgt cttcgcgcac tactccaaca tcaactccac cggcttccgt       120
     gagctccagg agggccaggc ggtgaccttc gacatcaccc agggccagaa gggcccgcag       180
     gcggagaaca tcaccaccgc ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page