(data stored in ACNUC7421 zone)

EMBL: AP009493.PE463

AP009493.PE463       Location/Qualifiers
FT   CDS_pept        complement(543783..544160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_463"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17292"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ1"
FT                   /protein_id="BAG17292.1"
FT                   /translation="MSRQRRSAVLLAAFMGGAGVLHFAAPKVFDDTVPRMLPGQPRTWT
FT                   YASGVVELALAAGLAHPGTRAVAARATAGFFVGVFPANVQMAVDWRHRPRPQRIAAWAR
FT                   LPLQAPLVLWARGVARGADGP"
     atgtcccgcc agaggcgttc cgccgtcctg ctcgccgcgt tcatgggcgg agccggagtc        60
     ctgcacttcg ccgccccgaa ggtcttcgac gacaccgttc cccggatgct gcccgggcag       120
     ccccgcacgt ggacgtacgc cagcggggtg gtcgaactcg ccctggccgc cggcctcgcc       180
     caccccggga cccgggcggt cgccgcccgg gccaccgcgg gcttcttcgt cggtgtgttt       240
     ccggccaatg tgcagatggc cgtcgactgg cgccaccggc cccgtccgca gcggatcgcg       300
     gcctgggccc gactgcccct ccaggcgccg ctggtcctgt gggcgcgggg tgtcgcccgg       360
     ggtgccgacg gcccctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page