(data stored in ACNUC7421 zone)

EMBL: AP009493.PE464

AP009493.PE464       Location/Qualifiers
FT   CDS_pept        complement(544227..544544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_464"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17293"
FT                   /db_xref="GOA:B1VQJ2"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ2"
FT                   /protein_id="BAG17293.1"
FT                   /translation="MIRRFAAAFGRVAFPSALFTAAGYVLATRTPGPYQRLFEDQWDAI
FT                   LTGAAVTMCGVLASAYGVRLCFSVLGGFQPDNVRRGVLALVAGVLVGGVGLSLLWRLLA
FT                   L"
     gtgatccgac gattcgcggc cgccttcggc cgggtggcct tcccctcggc cctgttcacc        60
     gcggccggat acgtactggc cacgcggacg ccggggccgt accagcggct gttcgaggac       120
     cagtgggacg ccatccttac cggggccgcc gtcaccatgt gcggggtgct ggcctcggcc       180
     tacggtgtgc ggctgtgctt cagcgtgctc ggcggattcc agcccgacaa cgtgcggcgg       240
     ggcgtgctgg ccctggtcgc cggagtgctc gtcggcggtg tgggcctgtc gctgctctgg       300
     cggctgctgg cgctctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page