(data stored in ACNUC7421 zone)

EMBL: AP009493.PE465

AP009493.PE465       Location/Qualifiers
FT   CDS_pept        complement(544541..544981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_465"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17294"
FT                   /db_xref="GOA:B1VQJ3"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ3"
FT                   /protein_id="BAG17294.1"
FT                   /translation="MAAIEDGAAFLRTLADAERRLAGVQALGARRRRVRRPRIASASLA
FT                   ALIPGILAVAAVAGGGPGSLLVAVGLSVAALSLAACVTLLLRIERPLKRRFVAEEQAMI
FT                   EEVNRMRELFTHIAERDRWEERLKRSVRERLSRFPVDGGSLR"
     atggccgcga tcgaggacgg agcggcgttc ctgcggacgc tggcggacgc ggaacgccgg        60
     ctggcgggcg tccaggccct gggtgcgcgg cggcgtcggg tgcgccggcc ccggatcgcg       120
     tcggcctccc tcgcggcgtt gatcccgggg atcctcgccg tcgccgccgt ggcgggcggc       180
     ggtcccggga gcctgctcgt cgcggtcggc ctgtccgtgg ccgcgctctc gctcgcggcg       240
     tgcgtcaccc tgctgctgag gatcgaacgg ccgctgaagc gccggttcgt ggcggaggaa       300
     caggccatga tcgaggaggt gaaccggatg cgcgagctgt tcacccatat cgcggagcgg       360
     gaccggtggg aggaacggct gaagcggtcg gtccgcgaac ggctctcccg ctttcccgtg       420
     gacggggggt ctctccggtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page