(data stored in ACNUC7421 zone)

EMBL: AP009493.PE466

AP009493.PE466       Location/Qualifiers
FT   CDS_pept        complement(544983..545846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_466"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17295"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQJ4"
FT                   /protein_id="BAG17295.1"
FT                   /translation="MPDVWENTRSRWESVRHAVDGGPAAGVVAATLHGRPGLSVNPIAV
FT                   TGEAGVGKSVLYDALTQSIRTGDHDSSRSPDIEKHATVLRFGSRRTRAAVTVIPGQLST
FT                   QREKALQDTMRGDASPHGIVHVVAWGHNRIWQRASQRDVHAALAADGDVDQEAVRNWHR
FT                   RKEVADFRLLVDEIIEGQAAQRLRWLIVAVSKCDLYWDRLDEARDYYIPGQAPRESPFA
FT                   LLMRDLENETSLRLSVLPMVSRLMRHQYLPGLPLGTSQLDDAQIGALRTYFGQELHSFI
FT                   TQRNGH"
     gtgcccgacg tctgggagaa cacccgatca cggtgggaga gcgtccggca cgcggtggac        60
     ggcggtccgg cggccggggt cgtcgcggcc accctgcacg gacggcccgg cctctcggtc       120
     aaccccatcg ctgtcaccgg cgaggcgggg gtgggcaaga gcgtcctgta cgacgcgctg       180
     acgcagtcca tccgcaccgg tgaccatgac agctcccgca gccccgacat cgagaagcac       240
     gccacggtcc tgcggttcgg cagccgccgc acccgggccg ccgtcaccgt catccccggg       300
     cagctgtcca cccagcggga gaaggccctc caggacacga tgcggggcga cgcctccccg       360
     cacggcatcg tccacgtcgt cgcgtggggg cacaacagga tctggcagcg cgcctcccag       420
     cgtgacgtcc acgcggcgct cgccgccgac ggcgacgtcg accaggaagc cgtgcggaac       480
     tggcaccgcc gcaaggaggt cgccgacttc cgtctcctgg tcgacgagat catcgagggg       540
     caggcggccc aacggctgcg atggctgatc gtcgccgtct ccaagtgcga tctgtactgg       600
     gaccggctgg acgaggcacg cgactactac atcccggggc aggccccccg ggagtccccg       660
     ttcgccctgc tcatgcgtga cctggagaac gagacgtcgc tccgcctgtc cgtcctcccg       720
     atggtgtccc ggctcatgcg ccaccagtac ctcccggggc tgcccctggg cacctcgcaa       780
     ctggacgacg cgcagatagg cgcgttgcgc acctatttcg gccaggaact ccattcgttc       840
     atcacgcagc ggaacgggca ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page