(data stored in ACNUC7421 zone)

EMBL: AP009493.PE47

AP009493.PE47        Location/Qualifiers
FT   CDS_pept        complement(50758..51168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_47t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_47t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16876"
FT                   /db_xref="GOA:B1VLX5"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLX5"
FT                   /protein_id="BAG16876.1"
FT                   /translation="MDPAIRAAIEITPAAGTRDRIVDITTTGRRTGRPRRIEIFFYRAA
FT                   GRTYLCSGTSGRPTSWYANLLAHPDFTFHLKQGIRSDIRARAVPVTDQEERRRILTEIV
FT                   TDLNQPHNPGTITQPTHLRDWLDSRLVRVTFP"
     atggacccgg cgatacgcgc cgccatcgag atcacccccg ccgcaggcac ccgcgaccgg        60
     atcgtcgaca tcaccacgac cggccgccgc accggccgcc cccgacggat cgaaatcttc       120
     ttctaccgcg ccgccggccg gacctacctc tgcagcggca cctccggccg tccgaccagc       180
     tggtacgcca acctcctggc ccatccggac ttcaccttcc acctgaagca aggcattcgc       240
     tctgacatcc gtgcccgggc cgttcccgtc accgaccagg aggaacggcg ccgcatcctg       300
     accgaaatcg tcaccgacct caaccagccc cacaatcccg gcaccatcac ccagcccacc       360
     cacctccggg actggctgga cagcagactg gtccgcgtca ccttcccctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page