(data stored in ACNUC7421 zone)

EMBL: AP009493.PE473

AP009493.PE473       Location/Qualifiers
FT   CDS_pept        551449..552342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_473"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17302"
FT                   /db_xref="GOA:B1VQK1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK1"
FT                   /protein_id="BAG17302.1"
FT                   /translation="MDAVDRVSPAGAGTAGAGEARAGRGSRVVGLALACHPGPALAVTA
FT                   LACALALGSGLGGPRSALVTAAVLTGQLSVGWCNDAYDARRDADAGRRGKPAADGTVGA
FT                   RAVWVAAGVAFALCVPLSLACGVLAGTVHLAAVAAAWLYNLRLKATALSWLPYVAGFGA
FT                   LPATVALSVPGGPWPRWWTVTAGALLGFAAHLADTLPDIAADRAAGIRGLPHRLGDRGT
FT                   RLLLPVPLLGATAVLAFGPPGPVGAAGAAALVLAGAASLAGPALGRRRRKAALAGAVAV
FT                   AAVDLALLLARGVGGA"
     atggacgccg tggacagggt gagcccggcc ggtgcgggga cggccggcgc gggagaggcc        60
     cgcgcggggc ggggaagccg cgtcgtgggg ctcgcgctcg cgtgccaccc gggaccggcg       120
     ctcgcggtga ccgccctcgc gtgcgccctc gctctcggct ccggactcgg cggccctcgc       180
     tccgcgctgg tcacggcggc ggtgctgacc ggccagctct cggtgggctg gtgcaacgac       240
     gcgtacgacg cgcggcgtga cgccgacgcc ggccgccggg ggaagccggc ggccgacggc       300
     acggtcggag cgcgtgcggt gtgggtggcg gcgggggtcg cgttcgccct gtgcgtaccg       360
     ctctcgctgg cctgcggggt cctcgcgggc acggtgcacc tggccgcggt cgccgcggcc       420
     tggctctaca acctgcggct caaggcgacc gctctgtcct ggctcccgta cgtggccgga       480
     ttcggcgccc tgcccgccac cgtcgccctc tccgtgcccg gcggaccgtg gccccggtgg       540
     tggacggtga cggccggggc gctgctcggg ttcgcggcac atctggccga cacgctcccg       600
     gacatcgcgg cggaccgggc ggccgggatc cggggcctcc cgcaccggct gggcgaccgg       660
     ggcacccggc tgctgctgcc ggttccgctg ctcggtgcca cggcggtgct ggcgttcggg       720
     ccgccgggac cggtgggtgc ggcgggcgcc gctgccctcg tcctggccgg tgcggcgtcg       780
     ctcgcgggac cggccctcgg ccgccgccgg cgcaaggccg ccctggccgg agcggtggcc       840
     gtggccgcgg tggatctggc gctgctgctg gcccggggtg tcggcggagc ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page