(data stored in ACNUC7421 zone)

EMBL: AP009493.PE476

AP009493.PE476       Location/Qualifiers
FT   CDS_pept        556653..557132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_476"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17305"
FT                   /db_xref="GOA:B1VQK4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK4"
FT                   /protein_id="BAG17305.1"
FT                   /translation="MIIDIPEGQEPIGYVWGEMVPGIGMAAATFSMSVYEHTTLGLREF
FT                   EAARLRVAQINGCLFCLDWRTERDGAKVEEEFAGAVTEWRTTDAFDERTRLAAEYAERY
FT                   TLDHHGLDDAFWQRMTAHYSQAEIVELTMSIGSWLAFGRLNHVLGIDAVCVLPGH"
     atgatcatcg acattcccga gggtcaggag cccatcggtt acgtgtgggg ggagatggtc        60
     cccggcatcg gcatggccgc cgccaccttc tcgatgtccg tgtacgagca cacgacgctg       120
     gggctgcggg agttcgaggc ggccaggctg cgggtcgcgc agatcaacgg gtgcctgttc       180
     tgcctggact ggcggaccga gcgggacggg gcgaaggtcg aggaggagtt cgccggggcg       240
     gtgaccgagt ggcgtacgac cgacgccttc gacgagcgga cccggctggc ggcggagtac       300
     gccgagcggt acacgctcga ccaccacggt ctggacgacg ccttctggca gcggatgacc       360
     gcgcactaca gccaggcgga gatcgtggag ctgacgatga gcatcggctc gtggctggcg       420
     ttcgggcggc tcaaccatgt gctggggatc gacgcggtgt gcgttctgcc cggtcactga       480
//

If you have problems or comments...

PBIL Back to PBIL home page