(data stored in ACNUC7421 zone)

EMBL: AP009493.PE478

AP009493.PE478       Location/Qualifiers
FT   CDS_pept        complement(559010..559852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_478"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17307"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK6"
FT                   /protein_id="BAG17307.1"
FT                   /translation="MPAQGKHRRSPSTSLRRGLAAVTAGGAVLALPVIGATSAFAAPAP
FT                   TAAPQQSVAPAAVAPANSVAKAAPAQHSVAAGETLSKIAREYSVSGGWEKLYEGNRKII
FT                   GANPDLIHPGIKLTLGTVADASSGGTADKAAKASPSAARGAEADRADRSERIDAAPVAK
FT                   TAPAAEKAVTYTNDLDGWIKESLAIMAEQGIPGTYEGIHRNIMRESSGNPAAINNWDSN
FT                   AVKGTPSKGLLQVIDPTFQAYHVPGTSTDSYDPVANITAACNYAADRYGSIDNVFGAY"
     atgcccgcac agggtaagca ccgtcgttcc ccgtccacct cgctgcgtcg cggcctggcc        60
     gccgtgaccg ccggcggagc cgtcctcgcc ctcccggtga tcggcgccac cagtgccttc       120
     gcggcacccg cgcccaccgc cgcgccgcag cagtccgtgg cgcccgccgc ggtggccccg       180
     gcgaattccg tggcgaaggc cgcgcccgcc cagcattccg tcgcggccgg tgagacgctt       240
     tccaagatcg cccgcgaata ttccgtcagc ggcggctggg agaagctcta cgaaggcaac       300
     cggaagatca tcggagcgaa tcccgatctc attcaccccg gtatcaagct gactctcgga       360
     accgtggccg atgcctcttc gggtggtacg gcggacaagg ccgccaaggc ttctccgtcc       420
     gccgcgcgcg gcgccgaggc cgaccgcgcc gaccgctcgg agcgcatcga cgccgccccc       480
     gtggcgaaga ccgctccggc cgccgagaag gccgtcacgt acacgaacga cctcgacggc       540
     tggatcaagg agtccctggc gatcatggcc gagcagggca tccccggaac ctacgagggc       600
     atccaccgca acatcatgcg cgagtcctcg ggcaacccgg ccgcgatcaa caactgggac       660
     tccaacgcgg tcaagggcac cccgtccaag ggtctgctgc aggtcatcga cccgaccttc       720
     caggcctacc acgtgcccgg cacctcgacc gacagctacg acccggtcgc caacatcacc       780
     gccgcgtgca actacgccgc ggaccggtac ggctcgatcg acaacgtctt cggcgcctac       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page