(data stored in ACNUC7421 zone)

EMBL: AP009493.PE481

AP009493.PE481       Location/Qualifiers
FT   CDS_pept        complement(564571..565188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_481"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17310"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQK9"
FT                   /protein_id="BAG17310.1"
FT                   /translation="MRTLRTAVLTAAAAALAVTALAPVPAAAAPAPAPVQPKFLSAGQL
FT                   PASATPWTAGPVRQGTPAEGSVCTAGIAPASGTRHRDFRTELDTGARQTITLAPTTARA
FT                   KALAAELRSALETCLDRLKEQNPGLEGEAFYQGRVDIEEGAHVYSIDTSYPEVGSTDIG
FT                   LYSVGRDGRAVTVVEWGQLGELDGAPLEGFTNTTRTAVAKLY"
     atgcgcaccc ttcgcaccgc agtcctgacc gcggccgccg ccgccctggc cgtcaccgca        60
     ctggcccccg tgcccgccgc ggcggcgccg gcccccgctc ccgtccagcc gaagttcctg       120
     agcgcgggcc agctgcccgc atccgccaca ccctggaccg ccggtcccgt acgccagggg       180
     acgcccgcgg aagggtcggt gtgcaccgcg ggcatcgccc cggcgtccgg cacccgccac       240
     cgggacttcc gcaccgaact ggacaccggc gcccgccaga ccatcacgct cgcccccacc       300
     accgcccggg ccaaggcgct cgccgccgaa ctgcgcagcg ccctggagac ctgcctcgac       360
     cggctgaagg agcagaaccc gggcctggag ggggaggcgt tctaccaggg ccgtgtcgac       420
     atcgaggagg gcgcgcacgt ctacagcatc gacacgtcgt acccggaggt cggctccacc       480
     gacatcgggc tgtactccgt gggccgcgac ggcagggccg tgaccgtcgt cgagtgggga       540
     cagctgggcg aactcgacgg cgcacccctg gagggcttca cgaacacgac gcgcaccgcc       600
     gtcgccaagc tgtactga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page