(data stored in ACNUC7421 zone)

EMBL: AP009493.PE482

AP009493.PE482       Location/Qualifiers
FT   CDS_pept        565377..566933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_482"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17311"
FT                   /db_xref="GOA:B1VQL0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL0"
FT                   /protein_id="BAG17311.1"
FT                   /translation="MGVLGGLERPGTAVGRSSVTGGAEGSARVVLAERLSALRERSGRT
FT                   YASLARRIGVSGSTLHRYCTGRTVPAEFAPVERLARLCGAPAGEREALHRLWILADRER
FT                   LDRQAAEGGAEGEADAAAEATDVGPVDGSAGRRAAGPHASGAGPSGSAGSGTPPSALPG
FT                   PLGRPGPRPGPGPAVGRVAAIGSGTPRGPASRSRRARRYGPGLGVLAAGALAVALVAAL
FT                   GGTSPPAPDRGPSVAQRPGGPPSGSPDPSVSGSPAPRTPRATAGGTDRATPSGGTGPAT
FT                   VPPGVEQRSKALPRASGGSPSAKAGRVPFTWSADAHVWKNGCDHSYLLDRVPTAVPPPP
FT                   VEADAESWAGALGAVHAGEAGVRITLQGRDERAVVLEALRIQVVERRSPAPGRVYRMSS
FT                   GCGGSLTPRMFDVDLDAPRPTARPVAGNDSGEPIAAVSFPYSVSVTDPEVLLITARAVG
FT                   CDCDWYAELTWSSGGRSGTVRVDDGGRPFRTSGTGGRPVFDYDTATGRWVSVPDAGEAA
FT                   S"
     gtgggtgttc tcggggggct ggaacgccct ggaacggctg tggggaggtc gagcgtgacg        60
     ggtggggccg aggggtccgc acgggtggtg ctggcggagc ggctgagcgc gctgcgggag       120
     cggtcgggcc ggacgtacgc gtcgctggcc cgtcggatcg gggtcagcgg ctcgacgctg       180
     caccggtact gcacggggcg gacggtgccc gcggagttcg cccccgtgga gcggctggcc       240
     cggctgtgcg gcgctccggc cggggagcgg gaggcgttgc accggctgtg gatcctggcg       300
     gaccgcgaac gtctggatcg gcaggcggcg gagggcggag ccgaggggga ggcggacgcc       360
     gcggctgagg cgacggacgt cgggccggtg gacggctccg ccgggcggcg ggcggcgggg       420
     ccgcacgcct ccggggccgg tccgtccggc agtgccgggt ccgggacgcc gccgtccgca       480
     ttgcccgggc ccttgggccg cccgggccct cgcccggggc cgggccccgc cgtcgggcgg       540
     gtggccgcga tcgggagcgg gactccccgg gggccggcgt cccggtcgcg tcgggcacgc       600
     cggtacggtc cggggctcgg cgtgctcgcc gccggggcgc tcgccgtcgc cctggtcgcg       660
     gccttgggcg ggacgtcgcc cccggctccg gaccggggcc cgtcggtggc ccagcggccg       720
     ggcgggcccc cgtcgggcag cccggatccc tcggtctccg gctcccccgc gccccgcacg       780
     ccgcgggcaa cggccggcgg gaccgaccgc gcgacgccct cgggcggcac cgggccggcg       840
     accgtgccgc ccggcgtcga acagcgctcg aaggcgctcc cccgggcatc cgggggctca       900
     ccgagcgcga aggcgggccg tgtgccgttc acctggagcg cggacgccca cgtctggaag       960
     aacggctgtg accactccta cctcctggac cgggtgccga cggccgtccc gccgcccccg      1020
     gtggaggcgg acgcggagtc ctgggccgga gcgctcggcg cggtgcacgc gggcgaggcc      1080
     ggtgtccgga tcacgttgca gggccgggac gagcgggccg tggtgctcga agccctgcgg      1140
     atccaggtgg tcgagcgccg ttcaccggcg ccgggacggg tctaccggat gagctccggc      1200
     tgcggggggt ccctcacgcc gaggatgttc gacgtggacc tcgacgcgcc ccgccccacc      1260
     gcccgcccgg tcgcgggcaa cgactcgggc gagcccatcg ccgcggtctc cttcccgtac      1320
     agcgtctccg tcacggatcc cgaggtcctc ctgatcacgg cgcgcgcggt cggctgcgac      1380
     tgcgactggt acgcggagct gacctggagc agcgggggcc ggtccggcac ggtgcgcgtc      1440
     gacgacggcg gacggccctt ccgtacgagt gggacggggg gacgccccgt gttcgactac      1500
     gacacggcca ccgggcgctg ggtgtccgtg ccggatgccg gggaggccgc gtcctga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page