(data stored in ACNUC7421 zone)

EMBL: AP009493.PE486

AP009493.PE486       Location/Qualifiers
FT   CDS_pept        568835..569506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_486"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17315"
FT                   /db_xref="GOA:B1VQL4"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL4"
FT                   /protein_id="BAG17315.1"
FT                   /translation="MSREVSASARRITDALLDGYGRTYAQEAGIRLRDTPQPLYRLLVL
FT                   SHLLSARIRASIAVSAARALFADGLRTPRRMAGASWQQRVDALGEGGYRRYDERTSTQL
FT                   GEGARLVLDVWKGDLRRLRAEADGSADAVCDGLQRVRGIGPAGADIFVREVQDLWPETG
FT                   FRAGAKGLRGAEKLGLPTSPGALARLAPDGGRAAFAAALVRAALDEEVVKTVREKARAP
FT                   S"
     atgagccgcg aggtgtccgc gtcggcgcgc cggatcaccg acgcgctgct cgacggatac        60
     gggcggacct acgcacagga ggcggggatc cggctgcgcg acaccccgca gccgctctac       120
     cggctcctgg tgctgagtca tctgctgagt gcccggatcc gggcgtcgat cgccgtgtcg       180
     gccgcgcggg cgctgttcgc ggacggcctg cgcaccccgc gccgaatggc cggggcgtcc       240
     tggcagcagc gggtggacgc gttgggcgag ggcggctacc ggcgctacga cgagcggacc       300
     tccacccagc tcggggaggg cgcccgtctc gtcctcgacg tctggaaggg cgatctgcgc       360
     cgcctgcgcg cggaggcgga cggcagcgcg gacgcggtgt gcgacgggct ccagcgggtc       420
     cggggcatcg ggccggccgg ggccgacatc ttcgtgcgcg aggtacagga cctctggccg       480
     gagaccgggt tccgggccgg agcgaagggc ctccgcgggg ccgagaagct cggcctgccc       540
     acctcccccg gcgcactggc ccggctcgcg cccgacggcg gccgggccgc gttcgcggcg       600
     gcgttggtca gggcggccct cgacgaggag gtcgtcaaga cggtccggga aaaggctcgc       660
     gccccgagtt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page