(data stored in ACNUC7421 zone)

EMBL: AP009493.PE487

AP009493.PE487       Location/Qualifiers
FT   CDS_pept        complement(569647..569871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_487"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17316"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL5"
FT                   /protein_id="BAG17316.1"
FT                   /translation="MEGESAYLPRGMEAAVGKSTDIARAKARRLKGMIKESDGIALENE
FT                   RLKAEGRREQAEARREEALARAARAASDR"
     gtggaggggg aaagcgcgta tctccctcgc ggcatggagg cagctgtggg aaagagcacc        60
     gacatagccc gcgccaaggc gcggaggctc aaaggcatga tcaaggaatc ggacggcatc       120
     gccctcgaga acgagcggct gaaggccgag ggcaggaggg aacaggccga ggcccgccgc       180
     gaggaggccc tggcacgcgc ggcgcgggcg gcctccgacc gctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page