(data stored in ACNUC7421 zone)

EMBL: AP009493.PE488

AP009493.PE488       Location/Qualifiers
FT   CDS_pept        complement(569903..570292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_488"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17317"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL6"
FT                   /protein_id="BAG17317.1"
FT                   /translation="MLAAMEQREVVKRVIGILTEAREMQRLLEADLEREDLDAGAGAVT
FT                   ALLNETMPHIAIPDDFSVEEVVTVVGREVGGAVEQLVSAFTLAFTMLAQVHDSGQTDVS
FT                   SADVLQDLALRVEGGGPDDDENPLL"
     atgctcgcgg ccatggagca acgggaagtc gtgaagcgcg tgatcggcat cctcacagag        60
     gcgcgcgaaa tgcagcgtct gctggaggcg gacctcgaac gggaagatct ggacgcggga       120
     gcgggcgccg tcaccgccct gctgaacgag acgatgcccc acatcgccat ccccgacgac       180
     ttctccgtgg aggaggtggt caccgtcgtc gggcgcgagg tcggcggtgc ggtcgaacag       240
     ctcgtgagcg ccttcaccct cgcgttcacg atgctggccc aggtccacga ctccgggcag       300
     accgacgtgt cgtcggcgga cgtcctccag gacctcgcgc tgcgggtcga gggcggtgga       360
     ccggacgacg acgagaatcc cctgctgtag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page