(data stored in ACNUC7421 zone)

EMBL: AP009493.PE489

AP009493.PE489       Location/Qualifiers
FT   CDS_pept        570380..570745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_489"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17318"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL7"
FT                   /protein_id="BAG17318.1"
FT                   /translation="MERDPNSPAVELTPAAAGLLRRLRADHGPLMFHQSGGCCDGSAPM
FT                   CYPAGEFRTGNADVLLADLAVEGMSESVPFWMSRSQYEVWSHTRLIVDVVEGRGSGFSL
FT                   EAPEGVRFLIRSRLVDG"
     atggagcgtg acccgaattc tcccgccgtc gagctgacgc ccgccgcggc cggtctgctg        60
     cggcggctgc gggcggacca cggcccgctg atgttccatc agtcgggcgg ctgctgcgac       120
     ggcagtgcgc ccatgtgcta tccggccggt gagttccgca ccgggaacgc cgacgtgctg       180
     ctcgcggacc tcgccgtcga gggaatgtcc gagagcgtgc ccttctggat gtcgcggagc       240
     cagtacgagg tgtggtccca cacccggctg atcgtggacg tggtggaggg ccgcggcagc       300
     gggttctcgc tggaggctcc ggagggggtg cggttcctca tccgttcccg tctggtggac       360
     ggctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page