(data stored in ACNUC7421 zone)

EMBL: AP009493.PE490

AP009493.PE490       Location/Qualifiers
FT   CDS_pept        complement(570789..572378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17319"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL8"
FT                   /protein_id="BAG17319.1"
FT                   /translation="MPPPYRRALARALALTLAAATLTLAGPTAPALADEIPRAPGHRLV
FT                   AGYEGAPATASPVPGQAPPQHPFLAPNGRSGMHADAAGSGTHPYTGPLGRSPEVTSEKI
FT                   APVGGECATATFDAAGRLITVCGTFTGFLLKLLDPRTLDTLAEYKLPQRSSTVEAITRL
FT                   DFARIFKDTSGGAYFYLDDQDRVVLADSRQHVLRIAHRQGADGRWEFVVEDDWDLTGHV
FT                   PHDCVSWTNLFPSGTCDPVTSVMPDWQGRIWWVTRLGRVGTVDPGTSAVRSVRLDGEEI
FT                   QNSFSVDRNAVSIVSDHALYSFTAGPDGTPRIGWRQTYDRGTGTKPGSVNQGSGTTPDL
FT                   FGTAEQYVAITDNADDRMNVLVFRRGADVPADRRLVCSVPVFGHGQSTTDNSLISWGDS
FT                   LVVENNYGYENPTSLLLGRSVVGGVTRIDVRPDGSGCDTVWESAVRSPSTVPKLSTANG
FT                   LLYFYEKEPNVLGVDAWYLTAVDFRTGERRWRTLTGTGPAYDNNWAPLTIGPDGTAYAG
FT                   VFNGIVAVRDTS"
     atgcccccgc cgtaccgcag agcgctcgcc cgtgccctgg ccctgaccct cgccgccgcc        60
     acgctcacgc tggccgggcc cacggccccc gcactggcag acgagatccc cagagccccc       120
     ggccaccgcc tggtcgcggg gtacgagggc gcccccgcca ccgcgtcgcc ggtccccgga       180
     caggcgcccc cgcagcaccc cttcctcgca cccaacgggc gcagcggcat gcacgcggac       240
     gcggcgggca gcggcaccca cccctacacc ggaccgctcg gccggagccc cgaggtgacc       300
     agcgagaaga tcgccccggt cggcggcgag tgcgccaccg cgacgttcga cgcggccggc       360
     cggctgatca cggtctgcgg gacgttcacc ggcttcctgc tcaaactgct cgatccgcgc       420
     accctcgaca cgctcgccga gtacaagctg ccgcagcggt cgtccaccgt cgaggcgatc       480
     acccggctcg acttcgccag gatcttcaag gacacctcgg gcggcgccta cttctacctg       540
     gacgaccagg accgggtcgt cctcgccgac tcccgccagc acgtcctgcg catcgcccac       600
     cggcagggcg ccgacgggcg gtgggaattc gtcgtcgagg acgactggga cctcaccggg       660
     cacgtcccgc acgactgcgt gtcctggacc aacctcttcc ccagcggcac ctgcgacccg       720
     gtgacgtccg tgatgcccga ctggcagggc cggatctggt gggtcacccg gctcggccgg       780
     gtcgggacgg tcgacccggg cacctcggcc gtccggtccg tccggctcga cggcgaggag       840
     atccagaact cgttctccgt ggaccggaac gcggtctcca tcgtctccga ccacgccctc       900
     tacagcttca cggccggccc ggacggcact ccgcggatcg ggtggcgtca gacgtacgac       960
     cgaggcaccg gcaccaagcc cggttcggtg aaccaggggt cgggcaccac ccccgacctg      1020
     ttcggcaccg cggagcagta cgtcgcgatc accgacaacg cggacgaccg gatgaacgtc      1080
     ctcgtcttcc gccggggcgc ggacgtcccc gccgaccgtc gcctcgtctg ctcggtcccg      1140
     gtcttcggcc acgggcagtc gaccaccgac aactcgctga tcagctgggg cgacagcctc      1200
     gtcgtcgaga acaactacgg ctacgagaac cccacctcgc tgctgctcgg ccgcagtgtc      1260
     gtcggcggcg tcacccgcat cgacgtgcgc cccgacggca gcggctgcga caccgtgtgg      1320
     gagagcgccg tccgctcgcc ctccaccgtg ccgaagctgt ccacggccaa cgggctgctc      1380
     tacttctacg agaaggagcc caacgtcctc ggcgtcgacg cctggtatct gaccgccgtc      1440
     gacttccgta ccggtgaacg ccgctggcgg acgctcaccg gcaccggacc cgcctacgac      1500
     aacaactggg cgcccctcac cattggcccc gacggcaccg cctacgcggg cgtcttcaac      1560
     ggcatcgtcg cggtgcgcga cacctcctga                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page