(data stored in ACNUC7421 zone)

EMBL: AP009493.PE491

AP009493.PE491       Location/Qualifiers
FT   CDS_pept        complement(572536..573279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_491"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17320"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQL9"
FT                   /protein_id="BAG17320.1"
FT                   /translation="MSFPPSGRHAGAAHHEYCNTGLCCRCQMRIWTTKAGNERLCGPCA
FT                   ACCQDCGRAPAPHLDGLDGGLCAECRGLCGRCHARKRPDGTCSCDRWRENAKSNPRGYV
FT                   LQALPQQLLQALGGRIPSTVHDLIHQELANRSAGLLRERVERRWNLRWAHALHEKDEDG
FT                   RRRFSAQDIAEQLLMPGSCSDPQCEDGHRVTTDTPCTRCRQPLHRFVTSAADHTATPEH
FT                   ARAAAARIRRAMLENRSHRKPPPRG"
     atgtcttttc cgccctccgg ccggcacgcg ggcgccgcgc accacgagta ctgcaacacc        60
     ggcctgtgct gccggtgcca gatgcggatc tggacgacga aggcgggcaa cgagcggctc       120
     tgcggtccct gcgcggcctg ctgccaggac tgcggccggg cgcccgcacc ccacctggac       180
     gggctggacg gagggctgtg cgccgagtgc cgcggcctgt gcggccgctg ccacgcccgg       240
     aagcggcccg acggaacctg ctcctgcgac cgctggcggg agaacgccaa gagcaacccc       300
     cgcggctatg tcctccaggc cttgccgcag cagctcctcc aggcgctcgg cggccggatc       360
     cccagcaccg tccacgatct gatccaccag gagctggcga accgcagcgc gggtctcctg       420
     cgggaacgcg tcgaacgccg ctggaacctc cgctgggccc acgccctgca cgagaaggac       480
     gaggacggcc gccgccgctt cagcgcccag gacatcgccg aacaactgct gatgcccggc       540
     tcgtgctccg atccgcagtg cgaggacggc caccgcgtca ccaccgacac cccgtgcacc       600
     cgctgccggc agccgctgca ccgcttcgtc acctcggccg ccgaccacac cgcgaccccg       660
     gagcacgccc gggccgcggc ggcccgcatc cgccgggcga tgctggagaa ccgctcgcac       720
     cggaagcccc cgccgcgcgg ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page