(data stored in ACNUC7421 zone)

EMBL: AP009493.PE493

AP009493.PE493       Location/Qualifiers
FT   CDS_pept        complement(573704..574582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_493"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17322"
FT                   /db_xref="GOA:B1VQM1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR039559"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM1"
FT                   /protein_id="BAG17322.1"
FT                   /translation="MAHPTRRRALTVALATAAVAVAAPTATAVAAPARPSGPRPLRHAH
FT                   AHNDYLHPRPLRDALAHGFTSAEADVFLVGGDLLVAHEPATLDPTRTLASLYLEPLAAL
FT                   VRAGHGSVHPHHRAPLQLLIDIKADGVAAYRELDRQLRRHHRMLTRYRHGRVHPGAVTP
FT                   VISGDRAARAPMEAQHTRYAFYDGRLDDLGTAAPASFAPLVSANWTQTFGWLGAGPFPR
FT                   AERDRLRALVATAHREGRRIRFWATPDLPGPARDAVWSELLAAGVDHLNTDDLAGLERF
FT                   LRAHGAGAPTP"
     atggcccacc ccacccgccg tcgcgcgctc acggtcgccc tcgccaccgc cgccgtggcc        60
     gtcgccgccc ccaccgcgac ggcggtcgcc gcccccgccc gtccgagcgg cccgcgcccg       120
     ttgcgccacg cccacgcgca caacgactac ctgcaccccc ggccgctgcg cgacgcgctc       180
     gcccacgggt tcaccagcgc cgaggcggac gtcttcctcg tcggcggcga cctcctcgtg       240
     gcccacgagc ccgccacgct cgaccccacc cgcaccctcg cctcgctcta cctggaacca       300
     ctcgccgcct tggtccgcgc ggggcacggc agcgtccacc cgcaccaccg cgccccgctg       360
     caactcctca tcgacatcaa ggccgacggc gtcgccgcct accgcgaact ggaccgacaa       420
     ctgcgccgcc accaccggat gctcacccgc taccgccacg gccgcgtcca ccccggcgcg       480
     gtcaccccgg tcatctccgg cgaccgcgcc gcccgcgccc ccatggaggc gcagcacacc       540
     cggtacgcgt tctacgacgg ccgactcgac gaccttggta ccgcggcccc cgcctcgttc       600
     gccccgctcg tcagcgccaa ctggacccag accttcggct ggctcggcgc cggccccttc       660
     ccccgggccg agcgcgaccg gctccgcgcc ctcgtcgcca ccgcccaccg cgagggccgc       720
     cgcatccgct tctgggccac gcccgacctg cccggacccg cacgcgacgc cgtctggtcc       780
     gaactgctcg ccgccggggt cgaccacctc aacaccgacg acctggccgg tctggagcga       840
     ttcctccgcg ctcacggtgc cggcgccccc accccgtaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page