(data stored in ACNUC7421 zone)

EMBL: AP009493.PE494

AP009493.PE494       Location/Qualifiers
FT   CDS_pept        complement(574799..575479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_494"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_494"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17323"
FT                   /db_xref="GOA:B1VQM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM2"
FT                   /protein_id="BAG17323.1"
FT                   /translation="MLELTGITAGYDRRDPVVRDVSLRVAAGEAVGLLGPSGCGKSTLA
FT                   KVAALLHRPDAGTMTLDGTVIRGWRHRAPRERRTAVGVVFQQPRLSADPRLSLRELIAQ
FT                   PLRSTGRRRDVPERVAELAPLVGLSEELLERRPHAVSDGQLQRACLARALVLEPRLLIC
FT                   DEMTAMLDASTTAALVAVVERYRAASGASLLAVGHDRVLLERWCDRTVRWGEPSNGSER
FT                   PAVG"
     atgcttgagc tgaccgggat caccgccggc tacgaccgcc gcgaccccgt cgtccgcgat        60
     gtctccctgc gcgtcgcggc gggcgaggcg gtcgggctgc tgggccccag cggctgcggc       120
     aagtccaccc tggccaaggt cgccgccctc ctgcaccgcc cggacgccgg aaccatgacc       180
     ctcgacggca cggtgatacg cgggtggcgg caccgcgccc cgcgcgagcg gcgcaccgcc       240
     gtcggcgtcg tcttccagca gccccggctc tccgccgacc cccggctcag cctgcgcgaa       300
     ctgatcgccc agccgctgcg gtccaccggg cgccgccggg acgtccccga gcgggtggcg       360
     gaactggccc cgctggtcgg cctctccgag gaactgctgg agcgacgtcc gcacgcggtg       420
     agcgacggcc agctccagcg cgcctgcctg gcacgggccc tggtgctgga gccccggctg       480
     ctgatctgcg acgagatgac cgcgatgctc gacgcctcca cgacggccgc cctggtcgcc       540
     gtggtcgagc gctaccgcgc cgcgtccggg gcgtccctgc tcgcggtcgg ccacgaccgg       600
     gtgctgctgg agcgctggtg cgaccggacg gtccgctggg gcgagccgtc caacggaagc       660
     gagcgcccgg ccgtcggctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page