(data stored in ACNUC7421 zone)

EMBL: AP009493.PE495

AP009493.PE495       Location/Qualifiers
FT   CDS_pept        complement(575472..576473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_495"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_495"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17324"
FT                   /db_xref="GOA:B1VQM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM3"
FT                   /protein_id="BAG17324.1"
FT                   /translation="MTADRENTAVPVLDVRDLSVRFRMRGGRDIAAVTDARFTVAPGEC
FT                   LALVGESGCGKSVLASALLGLLPANAATTGSAVLGGDTDLLTADERTLARTVRGRRIGL
FT                   VPQSPAAHLTPVRTVRAQLEESLRELTGARGSELPKAAVEAAARASFPEGHLDRYPHEL
FT                   SGGLAQRAATALALVGDAPLLLADEPTTGLDRDLVERTVDELRRHTDEGRALLIITHDL
FT                   AAAERIADRVAVMYAGRIVEIAKAASFFGAPGPRHPYARGLLNALPERDFTPIPGMPPE
FT                   LGALPEGCAFAARCAHADTRCTGERPAFTAGLACHHAPTGRAHAATKESADA"
     gtgaccgccg accgcgagaa caccgctgtg cccgtcctcg acgtccggga cctctccgtc        60
     cgcttccgga tgcgcggcgg ccgggacatc gcggccgtca ccgacgcccg cttcaccgtc       120
     gcgccggggg agtgcctggc cctggtcggc gagagcggct gcggcaagtc cgtcctggcc       180
     tccgccctgc tcggcctgct gcccgccaac gcggccacca ccggcagcgc ggtcctcggc       240
     ggggacacgg acctgctgac cgccgacgag cgcaccctcg cccgcacggt acggggacgg       300
     cgcatcggcc tcgtaccgca gagtcccgcc gcccacctca cccccgtgcg cacggtccgg       360
     gcccagttgg aggagagcct gcgcgagctg accggggccc gggggagcga actgccgaag       420
     gccgccgttg aggccgccgc ccgcgcctcg ttccccgagg gccacctcga ccgctacccg       480
     cacgagctct ccggcggcct cgcccagcgc gccgcgaccg ccctggccct ggtcggcgac       540
     gccccgctgc tgctcgccga cgaaccgacc accgggctcg accgggacct cgtcgaacgg       600
     acggtggacg aactgcgccg ccacaccgac gagggccggg cgctgctgat catcacgcac       660
     gacctggccg ccgccgaacg gatcgcggac cgggtcgccg tgatgtacgc gggccggatc       720
     gtcgagatcg ccaaagcggc ctccttcttc ggcgcacccg gaccccgcca cccgtacgcc       780
     cgggggctgc tgaacgccct gcccgagcgg gacttcaccc cgatccccgg gatgccgccg       840
     gagctggggg cgctgcccga gggctgcgcc ttcgccgccc gctgcgcgca cgcggacacc       900
     cgctgcaccg gcgaacgccc ggcgttcaca gcgggcctgg cctgccacca cgcgccgacc       960
     ggccgggcac acgccgcgac gaaggagtcc gccgatgctt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page