(data stored in ACNUC7421 zone)

EMBL: AP009493.PE496

AP009493.PE496       Location/Qualifiers
FT   CDS_pept        complement(576470..577327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_496"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_496"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17325"
FT                   /db_xref="GOA:B1VQM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM4"
FT                   /protein_id="BAG17325.1"
FT                   /translation="MAETALARPGRATRRVRVVTSAVIVTAVALAVLVVPPLAQLDQQA
FT                   VDLANKLDPPSLAHPFGTDDVGRDLLLRCVYGLRVSLLVGLVAALTATVIGTAIGALAG
FT                   AFGGWTDRIVMRVVDALSSIPHLLLGIFIVAMFRPGVWPVIVSVALTHWISTARIVRSE
FT                   VLSLRSRPFIDAAVSGGASRTRVVVRHLLPGVLPQAGLAAVLMVPHAMWHESALSFLGL
FT                   GLPAHQASLGNLVQSARGSLLAGDWWPTLFPGLFLIIPTLALAGLAGAWRDRINPRRKS
FT                   ELML"
     atggctgaga ccgcactcgc ccggcccggg cgcgccaccc gccgcgtccg ggtcgtcacc        60
     tcggcggtga tcgtcaccgc cgtcgcgctc gccgtcctcg tcgtcccgcc gctggcccag       120
     ctcgaccagc aggccgtcga cctggccaac aaactcgacc cgccgtccct cgcccacccc       180
     ttcggcaccg acgacgtcgg ccgcgacctg ctgctgcggt gcgtctacgg gttgcgggtc       240
     tccctgctcg tcggcctggt cgccgccctc accgccaccg tcatcggcac cgcgatcggc       300
     gcgctcgccg gagcgttcgg cggctggacc gaccggatcg tgatgcgcgt cgtggacgcc       360
     ctgtcctcca tcccgcacct gctgctcggc atcttcatcg tcgcgatgtt ccggcccggc       420
     gtctggccgg tgatcgtctc ggtcgccctg acgcactgga tctccaccgc ccggatcgtc       480
     cgctccgagg tgctctcgct gcgctcgcgc cccttcatcg acgcggccgt ctccggcggc       540
     gcctcccgca cccgggtcgt cgtgcgccac ctgctgcccg gcgtgctgcc gcaggcggga       600
     ctcgcggcgg tgctgatggt cccgcacgcc atgtggcacg agtccgccct gtccttcctc       660
     gggctcggac tcccggccca tcaggcgagc ctcggcaacc tcgtccagtc cgcgcgcggt       720
     tcgctgctcg cgggtgactg gtggcccacc ctcttccccg gcctcttcct gatcatcccg       780
     accctcgcgc tcgcgggact cgccggagcc tggcgcgacc ggatcaaccc gcgccggaaa       840
     tcggagctga tgctgtga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page