(data stored in ACNUC7421 zone)

EMBL: AP009493.PE497

AP009493.PE497       Location/Qualifiers
FT   CDS_pept        complement(577320..578312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_497"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_497"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17326"
FT                   /db_xref="GOA:B1VQM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQM5"
FT                   /protein_id="BAG17326.1"
FT                   /translation="MSRRLPWGPMARMAGRRALSAVPVLGVVTFGVFAVAAASPFDPVK
FT                   AYAGTAGLTASQENLDQLRANLGVDQPLVARWWDWLTSALRGDLGDSSVMRQPVADVIA
FT                   ERMGWSVLLAATAFLVAILLGTGLGVLAARRPGGWLDRCVSSVAYTLEAAPAFWLGLLA
FT                   IWFFALKLDVLPAGGLTDAASDVVTFGQVGSHLVLPAAVLGISQLPWFFLYVRQGVADA
FT                   LAEDPVRGARARGLSERTVLLGHALRSGMLPMLTLIGSRVPELITGALLVETVFSWPGI
FT                   AAATVQAATSVDFSLLAALTVLATAAVLLGNLISDLLYGLADPRVAFDG"
     gtgagccgtc gcctcccctg ggggccgatg gcgcggatgg cgggacggcg ggccctgtcc        60
     gccgtccccg tcctcggcgt cgtcaccttc ggcgtcttcg ccgtcgccgc cgcgtccccc       120
     ttcgacccgg tcaaggcgta cgcgggcacc gccgggctca ccgcttcgca ggagaacctc       180
     gaccaactgc gggccaacct cggcgtcgac cagccgctgg tcgcccgctg gtgggactgg       240
     ctgacctccg ccctccgggg cgacctcggc gactccagcg tgatgcgcca gcccgtcgcc       300
     gacgtcatcg cggaacgcat gggctggtcc gtcctgctcg ccgcgaccgc cttcctcgtc       360
     gcgatcctcc tcggcaccgg actcggcgtc ctcgccgccc gcaggcccgg cggctggctc       420
     gaccggtgcg tcagctccgt cgcgtacacc ctggaagccg cccccgcctt ctggctcggg       480
     ctgctcgcca tctggttctt cgccctgaag ctcgacgtcc tgccggccgg cgggctcacc       540
     gacgccgcca gcgacgtcgt caccttcggc caggtcggct cccacctcgt gctgcccgcg       600
     gcggtcctcg gcatctccca gctgccgtgg ttcttcctgt acgtacgcca aggggtcgcc       660
     gacgcactgg ccgaggaccc ggtccgcgga gcccgcgccc ggggactgag cgaacgcacc       720
     gtgctcctcg gccacgccct gcgctccggg atgctgccga tgctcaccct catcggctcc       780
     cgggtccccg aactcatcac cggcgcgctg ctcgtcgaga cggtcttcag ctggcccggc       840
     atcgccgccg ccaccgtcca ggccgccacc tcggtggact tctccctgct cgccgcgctc       900
     acggtgctcg ccaccgccgc cgtcctgctc ggcaacctga tctccgacct cctctacgga       960
     ctcgccgacc cccgggtggc cttcgatggc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page