(data stored in ACNUC7421 zone)

EMBL: AP009493.PE5

AP009493.PE5         Location/Qualifiers
FT   CDS_pept        complement(5280..5813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_5t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_5t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16834"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK3"
FT                   /protein_id="BAG16834.1"
FT                   /translation="MPLVPFEEITHLFAEFEHTAFRLETRRGYATDRAGERFQAFQRGF
FT                   DPRPEPEHPWNVNVRDKAGQGAHFSRIRIVDEPPTDGQLFLIATAAGNVAAGEDIRVIS
FT                   RAVADSVGLPDYDFWLFDSRVLVRMHIDDTDTTTGVEVIEDPAAVLAACRARDTSWALA
FT                   VPTAQVWAQVRPPV"
     gtgccactgg tcccctttga ggagatcacc cacctgttcg ccgagttcga gcacacggcg        60
     ttccgtctgg agactcgccg cgggtacgca actgatcggg ccggggaacg gtttcaggcg       120
     ttccagcgcg gcttcgaccc tcgccccgag ccggagcatc cgtggaacgt caacgtgcgg       180
     gacaaggccg gacagggagc tcacttctcc cggatccgga tcgtcgacga accacccacc       240
     gacgggcagc tgttcctcat agcgaccgcg gccgggaacg tcgccgccgg cgaggacatc       300
     cgcgtcatca gccgggccgt cgcggactcc gtcggtctgc ccgactacga cttctggctg       360
     ttcgactccc gggtcctggt ccgcatgcat atcgacgaca ccgacaccac aacgggcgtc       420
     gaggtcatcg aggaccctgc tgcggtgctg gccgcctgcc gggcccggga cacgtcctgg       480
     gcgctggctg tgccgacggc gcaggtgtgg gcgcaggtac gccccccggt gtga             534
//

If you have problems or comments...

PBIL Back to PBIL home page