(data stored in ACNUC7421 zone)

EMBL: AP009493.PE504

AP009493.PE504       Location/Qualifiers
FT   CDS_pept        complement(584848..585582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_504"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17333"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQN2"
FT                   /protein_id="BAG17333.1"
FT                   /translation="MDSQRLAPMPADWQRALAVVAHPDDLEYGAAAAVAEWTDGGREVV
FT                   YLLASRGEAGIDTLSPEECAPVREREQRASAAVVGVRTVEFLDHRDGVIEYGVGLRRDI
FT                   AAAVRRHRPELVVTLNHRDTWGGAAWNTPDHRAVGRAALDAVADAGNRWIFPELGEQGL
FT                   DPWNGVRWTAVAGSDRPTHAVDVTAGLERSVRSLLEHRTYIEALTREDPERYCRTFLEG
FT                   MAKDAGERFGGRPAVTFEVFAH"
     atggactcgc agcgactcgc acccatgccc gccgactggc agcgcgccct ggccgtggtc        60
     gcccaccccg acgacctgga gtacggggcc gccgccgccg tggcggagtg gaccgacggc       120
     ggccgtgagg tcgtctacct gctcgccagc cgcggggagg ccgggatcga cacgctgtcg       180
     cccgaggagt gcgcgccggt gcgcgagcgg gagcagcggg cgagcgccgc cgtcgtcggc       240
     gtgcggaccg tggagttcct ggaccaccgc gacggcgtga tcgagtacgg cgtcggcctg       300
     cgccgcgaca tcgcggcggc cgtccgccgc caccgccccg agctggtggt caccctcaac       360
     caccgggaca cctggggcgg ggcagcctgg aacacccccg accaccgcgc ggtcgggcgc       420
     gccgcactgg acgccgtcgc cgacgcgggc aaccgctgga tcttcccgga gctcggcgaa       480
     caggggctcg atccgtggaa cggggtgcgc tggaccgccg tggcgggcag cgaccggccc       540
     acccacgcgg tcgacgtgac cgccggtctc gaacgttcgg tccggtcgct gctggaacac       600
     cgcacctaca tcgaggcgct gacccgggag gacccggagc gctactgccg gaccttcctg       660
     gagggcatgg ccaaggacgc gggcgagcgg ttcggcggcc ggccggcggt caccttcgag       720
     gtcttcgcac actga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page