(data stored in ACNUC7421 zone)

EMBL: AP009493.PE505

AP009493.PE505       Location/Qualifiers
FT   CDS_pept        585869..586441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_505"
FT                   /product="conserved hypothetical protein containing a
FT                   rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_505"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17334"
FT                   /db_xref="GOA:B1VQN3"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQN3"
FT                   /protein_id="BAG17334.1"
FT                   /translation="MPSPASLSPAQAAARLEEFTVIDVRAPGEYAAGHVPGALNIPLDK
FT                   LPDALPALKSASARGSLLVVCASGVRSTRACEILSGADIEAVTLTGGTSAWEGDGRGLD
FT                   RPEGARTTWPMERQVRLAAGSLVVAGLVAGIRFPAARWLSAGVGTGLVYSAVSNTCGMA
FT                   ALLSRLPHNRAPRAVGDLDATLEELQR"
     gtgcccagcc ccgcttccct ctcccccgcc caggccgcag cccgtctgga ggagttcacc        60
     gtcatcgacg tacgggctcc gggcgagtac gccgccggac acgtccccgg cgcactgaac       120
     atcccgctcg acaagctgcc ggacgcgttg cccgcgctca agtccgcctc cgcgcgcggt       180
     tcgctgctgg tggtctgcgc ctccggggtc cggtccacac gggcctgcga gatcctctcg       240
     ggagcggaca tcgaggccgt gacgctgacc ggcggcacct cggcctggga aggtgacggc       300
     cgcggcctgg accgccccga gggcgcgcgc accacctggc ccatggagcg tcaggtgcgg       360
     ctcgcggcgg gctcgctggt ggtggcgggg ctggtggcgg gcatccgctt ccccgccgcg       420
     cgctggctgt ccgcgggcgt cggcacgggc ctggtgtact cggcggtcag caacacgtgc       480
     gggatggccg cactgctctc caggctgccg cacaaccggg ccccgcgtgc cgtcggcgac       540
     ctggacgcca cgctggagga gctccagcgc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page