(data stored in ACNUC7421 zone)

EMBL: AP009493.PE507

AP009493.PE507       Location/Qualifiers
FT   CDS_pept        587949..589112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_507"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_507"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17336"
FT                   /db_xref="GOA:B1VQN5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQN5"
FT                   /protein_id="BAG17336.1"
FT                   /translation="MIRFEQVGKVYPDGTTAVDGLTFEVARGELVTLVGPSGCGKTTTM
FT                   MMVNRLIEPTSGRILVDGEDIAGVDPVKLRRRIGYVIQQVGLFPHRTVLDNTATVPALV
FT                   GWKRARARERAAELLDLVGLAPATYGSRYPAQLSGGQRQRVGVARALAADPPVLLMDEP
FT                   FGAVDPVVREHLQNEFLALQQRVRKTVLLVTHDIEEAVRMGDRIAVYGEGRIEQFDTPA
FT                   AVLGTPATPYVARFVGSDRGLKRLSVTAIEPEDLEEPPVARLEERAGAAAARLAAAGAR
FT                   WAVVLNGAGELHGWVSADALRSSGEEGTVGGLARRMDAWVPVGAPLKQAFSEMLQHDAG
FT                   WVAVLDGARFLGVLTPAKLHEALRRSVDADAQGVGREEVDFDSVADA"
     atgatccggt tcgagcaggt cggcaaggtc tacccggacg ggacgacggc ggtcgacggg        60
     ctgaccttcg aggtggcccg gggcgagctg gtgaccctgg tgggaccgtc cggctgcggc       120
     aagacgacca cgatgatgat ggtgaaccgg ctgatcgagc cgacctcggg ccggatcctg       180
     gtggacggcg aggacatcgc cggggtcgac ccggtgaagc tgcggcggcg gatcggctat       240
     gtgatccagc aggtgggcct cttcccgcac cggaccgtcc tggacaacac cgcgaccgtt       300
     ccggcgctgg tcggctggaa gcgcgcacgg gcccgggagc gggcggcgga gctgctggac       360
     ctggtgggcc tggccccggc gacgtacggc tcgcgttatc cggcgcagct ctccggcggg       420
     cagcgccagc gggtgggcgt ggcgcgggcg ctcgcggcgg atccgccggt gctgctgatg       480
     gacgagccgt tcggggcggt ggacccggtg gtgcgggagc atctccagaa cgagttcctg       540
     gcgctccagc agcgggtgcg caagacggtg ctcctggtga cgcacgacat cgaggaggcg       600
     gtgcggatgg gcgaccggat cgcggtgtac ggggaggggc gcatcgagca gttcgacacc       660
     ccggccgccg tgctcggcac cccggcgacc ccgtacgtgg cccggttcgt ggggtccgac       720
     cgggggctga agcggctgtc ggtcacggcg atcgagccgg aggacctgga ggagccgccg       780
     gtggcccggc tggaggagcg cgccggggcg gcggcggccc ggctggcggc cgcgggggcc       840
     cgctgggcgg tggtcctgaa cggcgcgggc gagctgcacg gctgggtgtc ggcggacgcg       900
     ctgcggtcgt ccggggagga ggggacggtg ggcggcctgg cccgccggat ggacgcgtgg       960
     gtgccggtgg gcgctccgct gaagcaggcg ttcagcgaga tgctccagca cgacgcgggg      1020
     tgggtggcgg tgctggacgg ggcccggttc ctcggggtgc tgacccccgc gaagctgcac      1080
     gaggcgctgc gccggtcggt ggacgccgac gcgcaggggg tgggacgcga ggaggtggac      1140
     ttcgattccg tggcggacgc gtag                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page