(data stored in ACNUC7421 zone)

EMBL: AP009493.PE509

AP009493.PE509       Location/Qualifiers
FT   CDS_pept        complement(590141..590440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_509"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17338"
FT                   /db_xref="InterPro:IPR018656"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQN7"
FT                   /protein_id="BAG17338.1"
FT                   /translation="MPAPQDILTPPSGTPRSRRVDALFSHGRLVAIPRKEARREQLLVH
FT                   LADTLFERERSYTEHEVNEALRTVHEDCSALRRYLVVAGLLVRTRDGSSYRRGR"
     atgcccgccc cacaagacat cctcactccg ccgtccggga cgcctcgctc ccgccgggtc        60
     gacgcgcttt tctcgcacgg ccgcctcgtc gcgatcccgc gcaaggaggc ccggcgggag       120
     cagttgctcg tgcacctcgc cgacacgctg ttcgagcggg agcgctcgta caccgagcat       180
     gaggtgaacg aggcgctccg caccgtccac gaggactgct ccgcgctccg ccgctacctc       240
     gtcgtggcgg ggctgctcgt ccggacccgg gacggcagca gctaccgccg cggacgctga       300
//

If you have problems or comments...

PBIL Back to PBIL home page