(data stored in ACNUC7421 zone)

EMBL: AP009493.PE510

AP009493.PE510       Location/Qualifiers
FT   CDS_pept        590752..591651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17339"
FT                   /db_xref="GOA:B1VQN8"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQN8"
FT                   /protein_id="BAG17339.1"
FT                   /translation="MPHAFQQSVITEFRANAGKVGGPFEGADLLLLTTTGARSGKPHTT
FT                   PLGYVRDGRRLLVVGSNLGAPLHPDWYRNLLARPAVTVELGDEEFESLAVPAEGARRDE
FT                   LFARVVAEAPGYADYQDATDRVLPVVVLERPDPDAAVPAITSLAGKLVETHTWLRAQLR
FT                   HVHAETEAHFAARGDRGAHDAPAPGLGLQIRQRCLAFCQALEFHHTAEDGHLFPAMEGH
FT                   HPRLGRVFDRLREEHRSIGAVQSALAALLADVAVAEPDRFRAELTRMTEELTAHLDYEE
FT                   EHLLPLLAGVPWPPAAAS"
     atgccccatg ccttccagca gtccgtcatc accgaattcc gtgccaacgc ggggaaggtc        60
     ggcggcccct tcgagggcgc cgacctcctc ctgctcacca ccaccggggc ccgctccggc       120
     aagccgcaca ccacaccgct cggatacgta cgcgacggcc gtcggctgct cgtcgtcggc       180
     tccaacctcg gcgcgccgct ccaccccgac tggtaccgca atctcctcgc ccgccccgcc       240
     gtgacggtcg agctgggcga cgaggagttc gagtccctcg ccgtaccggc cgaaggcgcg       300
     cgacgcgacg aactcttcgc ccgggtcgtc gccgaggcgc ccgggtacgc cgactaccag       360
     gacgccacgg accgggtgct gccggtggtg gtcctggagc ggcccgaccc cgacgcggcg       420
     gttcccgcga tcacctcgct cgccggcaag ctggtggaga cgcacacctg gctgcgggcc       480
     cagctccgcc acgtccacgc ggagacggag gcgcacttcg ccgcgcgggg cgaccgcggg       540
     gcccacgacg cgcccgcacc cggcctcggg ctccagatcc gccagcgctg tctggcgttc       600
     tgccaggccc tggagttcca ccacacggcc gaggacggcc acctgttccc ggcgatggag       660
     ggccaccacc cccgtctggg gcgcgtcttc gaccggctgc gggaggagca ccggagcatc       720
     ggggccgtcc agtcggcgct cgcggccctg ctggccgacg tcgccgtcgc ggagccggac       780
     cgtttccgcg ccgagctgac ccggatgacc gaggagctga ccgcccacct cgactacgag       840
     gaggaacacc tcctgcccct gctggccggt gtgccctggc ccccggccgc cgcctcctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page