(data stored in ACNUC7421 zone)

EMBL: AP009493.PE512

AP009493.PE512       Location/Qualifiers
FT   CDS_pept        complement(592615..593289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_512"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_512"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17341"
FT                   /db_xref="GOA:B1VQP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP0"
FT                   /protein_id="BAG17341.1"
FT                   /translation="MNTLSETWSWLTTAAHWSGPDGIGNRLGEHLYLTVVCLLISCLVA
FT                   LPVALVLGHLGKGGALAVNLSNIGRAVPTFAVLVLLLLTPLGTRGQWSTVIALVLFAVP
FT                   PLLTNAYVGMREVDRDVVRAARGMGMTGRQLLLGVELPLALPLILTGVRIAAVQLVATA
FT                   TIAALAGGGGLGRIITAGFNLASTPQVVAGAVLVAAFALLVEGLFEAGRRLAPRRGRAA
FT                   AP"
     gtgaacaccc tctccgaaac ctggtcctgg ctcaccaccg cagcccactg gtccggcccc        60
     gacggaatcg ggaaccggct cggcgaacac ctctacctca ccgtcgtctg cctgctcatc       120
     agctgcctgg tcgccctgcc cgtcgccctc gtcctgggcc acctcggcaa gggcggcgcg       180
     ctcgccgtca acctctccaa catcggccgg gccgtgccca ccttcgccgt gctggtcctg       240
     ctgctgctca cccccctcgg gacgcgcggg cagtggtcga cggtcatcgc gctggtgctg       300
     ttcgccgtgc cgccgctcct caccaacgcc tacgtcggga tgcgcgaggt cgaccgggac       360
     gtcgtccggg ccgcccgggg catggggatg accggccgcc agctgctgct gggcgtggaa       420
     ctgccgctcg ccctcccgct gatcctcacc ggcgtgcgga tcgccgccgt ccagctggtg       480
     gccaccgcca ccatcgcggc gctggccggc ggcgggggac tgggccggat catcaccgcg       540
     ggcttcaacc tcgcctccac cccgcaggtg gtggccggag cggtcctggt ggccgccttc       600
     gccctcctcg tcgagggtct cttcgaggcc ggacggcgcc tcgccccccg gcgcggccgg       660
     gcggccgccc cgtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page