(data stored in ACNUC7421 zone)

EMBL: AP009493.PE513

AP009493.PE513       Location/Qualifiers
FT   CDS_pept        complement(593315..593992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_513"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_513"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17342"
FT                   /db_xref="GOA:B1VQP1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP1"
FT                   /protein_id="BAG17342.1"
FT                   /translation="MTAPPDDCLARNEWICGAYLSSRREILVDAVLQHLQLTGAAVAVA
FT                   LLLAVPLAVAARRWRWAAGPVLGLTTILYTIPSLAMFSLLLPRYGLSAALVIAGLVLYS
FT                   LTLLVRNILAGLRAVPEETRQAARGMGYGPLRLLLAVELPLALPAAMAGLRIATVSAVS
FT                   LVTIGAIVGHGGLGNLIYSGMNTYFKAQVLTASVLCVVIAVAADLLLLGAGRLLTPWTR
FT                   RRA"
     gtgacggccc caccggacga ctgcctcgcc cgcaacgagt ggatctgcgg ggcctacctc        60
     tccagccgcc gcgagatcct cgtggacgcg gtcctgcaac acctccagct gacgggcgcc       120
     gcggtcgccg tcgcactcct gctcgccgtc cccctggcgg tggcggcccg ccggtggcgc       180
     tgggcggccg gcccggtgct cgggctgacg acgatcctgt acacgatccc gtcgctggcg       240
     atgttctcgc tgctgctgcc gcggtacgga ctctccgccg cgctggtgat cgcggggctc       300
     gtcctctact ccctgacgct gctcgtccgc aacatcctgg ccgggctccg ggccgtcccc       360
     gaagagaccc ggcaggccgc acgcggcatg ggctacgggc cgctgcgcct gctgctcgcc       420
     gtcgagctgc cgctcgccct gcccgccgcg atggccgggc tgcgcatcgc caccgtctcc       480
     gcggtctccc tggtcaccat cggggcgatc gtcggccacg gagggctggg caacctcatc       540
     tactccggca tgaacaccta cttcaaggcg caggtgctca ccgcctccgt cctgtgcgtc       600
     gtcatcgccg tcgccgcgga cctgctgctc ctgggagcgg gacggctgct gaccccctgg       660
     acccggaggc gggcgtga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page