(data stored in ACNUC7421 zone)

EMBL: AP009493.PE514

AP009493.PE514       Location/Qualifiers
FT   CDS_pept        594045..594203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_514"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17343"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP2"
FT                   /protein_id="BAG17343.1"
FT                   /translation="MGLELYEGAGPAGAGRAFDALEQLAEPAGVLDELGPEARRAVRHR
FT                   LRRTGRA"
     gtgggcctgg agctgtacga gggcgccggc cccgcggggg cggggcgcgc cttcgacgcg        60
     ctggagcagc tcgccgaacc ggccggggtg ctggacgagc tcggcccgga ggcccggcgg       120
     gcggtacgcc accggctgcg ccgcacgggg agggcgtga                              159
//

If you have problems or comments...

PBIL Back to PBIL home page