(data stored in ACNUC7421 zone)

EMBL: AP009493.PE52

AP009493.PE52        Location/Qualifiers
FT   CDS_pept        complement(54853..55542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_52t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_52t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16881"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLY0"
FT                   /protein_id="BAG16881.1"
FT                   /translation="MNRRMITVLALAAAVLASAAPATAVSAPTAVRAAPVAEVTTLADA
FT                   VGQVKVTEEDRTGYTRSSFRHWNAGENATDGCNTRAEVLLAEAVVAPTVGAGCKLTGGT
FT                   WTSYYDGQEVTSAGALDIDHMVPLAEAWDSGASAWTPARREAYANDQGAEVSLVAVTAR
FT                   SNRQKSDQDPADWMPPSPDAQCRYIGEWVSTKLRWQLTADDRELEALKVYADGPCENTI
FT                   VRYTPAA"
     atgaaccgac gaatgatcac cgtcctggcc ctcgccgcgg ccgttctggc ctcggctgcc        60
     cccgcgaccg ctgtctccgc acccacggcg gttcgggccg ctccggtggc ggaggtgacg       120
     acactggccg acgcggtcgg ccaggtgaag gtcaccgagg aggaccgcac cggctacacc       180
     cgctcgtcct tccgccactg gaacgctggt gagaacgcga ccgacggctg caatacccgc       240
     gcggaggtcc tcctcgccga ggcggtcgtc gcaccgaccg tgggcgccgg ctgcaagctc       300
     accggcggca cctggacgag ctactacgac ggccaggagg tcaccagcgc cggagccctc       360
     gacatcgacc acatggtccc gctcgccgag gcctgggact caggggcctc cgcctggacc       420
     ccggcccggc gcgaggcgta cgcgaacgac cagggggcgg aggtctccct ggtcgcggtg       480
     acggcccgca gcaaccgaca gaaaagcgac caggacccgg ccgactggat gccgccgtcc       540
     ccggacgccc agtgccggta catcggcgag tgggtctcga ccaagctccg ctggcagctc       600
     accgccgacg accgtgagct ggaggcgctg aaggtctatg ccgacggccc gtgcgagaac       660
     accatcgtcc gctacacccc cgccgcctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page