(data stored in ACNUC7421 zone)

EMBL: AP009493.PE520

AP009493.PE520       Location/Qualifiers
FT   CDS_pept        600208..601566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17349"
FT                   /db_xref="GOA:B1VQP8"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQP8"
FT                   /protein_id="BAG17349.1"
FT                   /translation="MAAVLTPPAPSAAAGPRATVRFPWSGLRSRWPLLPLVATVLLPAL
FT                   PSGAWGGAGPADVASALAVLVCAGRLLYLRQRPLSGTAPLVLGLPAVGFAVATVTAADP
FT                   AAALPGLVRYLQVFVLVPTAVYLLLRDAHGFRIVAGSLALLAVVQGVTGVHQYVTGTGA
FT                   SYMGEDIRAVGTFGPSDIMGMATVVAYGLLAAAACALRAPRNAPGPLRPCAAVLAVALV
FT                   VPLTLSFSRGVWVATVAALLVVLALAGRRQALTALAVLGAAGVVLVGGLGIGSEMIADR
FT                   AASVTRVTSTPDRSVSDRYALWGAAGAMWRERPATGVGLKGFPAHRDGHASIGLSSGSD
FT                   TAGAGQEFRRQALLSPHNMYLLVLGEQGLIGLTALVGSWAALLVGAVRRLYVARSRGHA
FT                   AVDCGLAAVALMTWQSVNFLYADIGGPTTVLSGIVLGLAAWWALAGPDRVSTV"
     atggccgctg tgctgacccc gcccgcgccg tcggcggcgg ccgggccccg cgcgaccgtg        60
     cgctttccgt ggagcggctt gcggagccgt tggccgctgc tgccgctggt cgccaccgtc       120
     ctgctgcccg ccctgccctc cggggcctgg ggcggggccg gtccggccga tgtggcgtcc       180
     gccctcgcgg tgctggtgtg cgcggggcgg ctgctgtatc tgcggcagcg tccgctgagc       240
     ggcacggccc cgctggtcct cggcctgccc gccgtgggct tcgcggtggc cacggtcacc       300
     gcggcggacc cggcggcggc cctgccgggg ctcgtgcgct acctccaggt cttcgtcctc       360
     gtgccgaccg ccgtgtacct gctgctccgg gacgcccacg ggttccggat cgtcgccggc       420
     tcgctcgccc tcctggcggt cgtccagggc gtcacgggcg tccaccagta cgtcaccggc       480
     accggcgcct cctacatggg cgaggacatc cgggcggtcg gcacgttcgg gcccagcgac       540
     atcatgggga tggcgaccgt cgtcgcctac gggctgctcg ccgccgcggc ctgcgccctg       600
     cgggcgccgc ggaacgcccc gggcccgctg cggccctgcg ccgccgtcct cgctgtcgcg       660
     ctggtcgtgc ccctgacgct gtcgttcagc cggggcgtgt gggtcgccac ggtcgccgcg       720
     ctcctcgtcg tcctggccct ggccgggcgg cggcaggccc tgacggcgct ggccgtgctg       780
     ggcgcggccg gggtggtcct ggtcggcggg ctcggcatcg gctccgagat gatcgcggac       840
     cgggccgcca gcgtgacccg ggtgaccagc acccccgacc ggtcggtcag cgaccgctac       900
     gcgctgtggg gcgcggcggg cgcgatgtgg cgggagcggc cggccaccgg ggtcggcctc       960
     aagggcttcc ccgcccaccg tgacggacac gcatccatcg ggctctcctc cggaagcgac      1020
     acggccgggg cgggccagga gttccggcgg caggcgctcc tctccccgca caacatgtat      1080
     ctcctggtcc tcggcgagca gggcctcatc ggtctgaccg cgctcgtcgg cagctgggcg      1140
     gcgctcctgg tcggcgcggt ccgcagactg tacgtcgcac gctcccgcgg acacgcggcc      1200
     gtggactgcg ggctggcggc ggtggccctg atgacctggc agagcgtcaa cttcctgtac      1260
     gccgacatcg gcgggcccac cacggtgctg agcgggatcg tgctggggct ggccgcctgg      1320
     tgggcgctgg ccgggccgga ccgggtgagc accgtatga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page