(data stored in ACNUC7421 zone)

EMBL: AP009493.PE525

AP009493.PE525       Location/Qualifiers
FT   CDS_pept        605869..607017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_525"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17354"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRD6"
FT                   /protein_id="BAG17354.1"
FT                   /translation="MTGRRAGGLVVTLCRDFGEFGALAGEWDALHRRCATATPFQSHAW
FT                   LHSWWISYGQEGRLRVLLVRRAGRLIGAAPLMLVHRPMPLLVPMGGAISDFFDILLDEE
FT                   EAGYAVGALGRGLDRAARHTVVDLREVRPDASAQLLFGRWAGARSRLTDSTCMELPAEP
FT                   LGDFVAGLTGSRGQRLRSKLRKVEALGVEAHRVPRDGVPAAIGTLLRLHERQWEGRGVN
FT                   PEHLRSRFSDHLVRSVGRMVGDGTAAMTEFRLNGAVVASNLSLQSGRLTGGYLYGADPA
FT                   LRERKVDVSTMLLREVAQQASDGGRTVLSLLRGAESYKNHWGPVPVVNQRLLLARPGLE
FT                   PLLRLRESQVAVRERAVETVKARFPAARDWHERLSGLPVIGR"
     atgacggggc gccgggcggg cggcctcgtc gtgaccctgt gccgggactt cggggagttc        60
     ggcgccctcg ccggggagtg ggacgcgctg caccgccgct gcgccaccgc gaccccgttc       120
     cagagccacg cctggctgca ctcgtggtgg atctcctacg gtcaggaggg ccggctgcgg       180
     gtgctgctgg tccgccgggc ggggcggctg atcggggcgg cgccgctgat gctggtgcac       240
     cgtccgatgc cgctgctcgt cccgatgggc ggggcgatct ccgacttctt cgacatcctg       300
     ctcgacgagg aggaggccgg gtacgcggtg ggggcgctgg ggcggggtct ggaccgggcg       360
     gcccggcaca ccgtggtgga cctgcgggag gtcaggcccg acgcgtcggc gcagttgctg       420
     ttcgggcggt gggccggggc ccggagccgg ctcaccgact cgacgtgcat ggagctgccg       480
     gccgagccgc tgggcgattt cgtggcgggg ctgacgggct cgcggggtca gcggctgcgc       540
     tccaagctgc gcaaggtcga agccctgggc gtcgaggccc accgggtccc gcgggacggg       600
     gtgcccgccg cgatcggcac gctgctgcgg ctgcacgaac ggcagtggga gggccggggg       660
     gtcaaccccg agcacctccg gtcgcggttc tcggaccacc tggtccggtc ggtgggtcgg       720
     atggtggggg acggcacggc ggccatgacc gagttccggc tgaacggcgc ggtggtggcg       780
     tccaacctgt cgttgcagtc cggccggctg acgggcggct acctgtacgg tgcggacccg       840
     gcgctgcgcg agcggaaggt cgacgtgtcg acgatgctgc tgcgcgaggt cgcccagcag       900
     gcttcggacg gcggccggac ggtgctgagc ctgctgcgcg gtgcggagag ctacaagaac       960
     cactgggggc cggtgcccgt ggtcaaccag cgactgctgc tggcgcggcc gggcctggag      1020
     ccgctgctgc ggctgcgcga gtcgcaggtg gccgtacggg agcgggccgt ggagaccgtg      1080
     aaggcccggt tcccggcggc gcgggactgg cacgagcggt tgtcggggct gccggtgatc      1140
     gggcgctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page