(data stored in ACNUC7421 zone)

EMBL: AP009493.PE53

AP009493.PE53        Location/Qualifiers
FT   CDS_pept        complement(55937..56413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_53t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_53t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16882"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLY1"
FT                   /protein_id="BAG16882.1"
FT                   /translation="MAAEEHAPDYPPKTPPPPKRPVSPPRPETSLAGTARARMQVRNRR
FT                   SANWSLEAAAWSPRKASGFVLGRLHEWGYREVDEAAAALTELLVLTAVADGGRRVSVHL
FT                   ADQKRQALIVALSHQPGLAAADTRVLPELTRLGAVSCGTDTADDGRRVWAVLDL"
     gtggccgccg aggagcacgc tccggactat ccgccgaaga ccccgccacc gcccaagcgc        60
     cccgtgtctc cgccgcgccc ggagacaagt cttgcgggta cggcccgggc caggatgcag       120
     gtgcggaacc ggcggtcggc gaactggtcg ctggaggccg ctgcgtggtc cccgcggaag       180
     gcgtcgggct tcgtgctggg gcggttgcac gaatgggggt accgggaggt cgacgaggca       240
     gcggccgcgt tgacggagct gctggtgctg accgcagtcg cggacggcgg acggcgggtg       300
     tccgtgcacc tcgcggacca gaagcggcag gcgctgatcg tcgctctgtc gcaccagccg       360
     ggactcgcgg ccgcggacac cagggtgttg ccggagctca ccaggctggg tgctgtgtcg       420
     tgcggcacgg acactgcgga cgacgggcgc agggtatggg cggtgctcga cctgtga          477
//

If you have problems or comments...

PBIL Back to PBIL home page