(data stored in ACNUC7421 zone)

EMBL: AP009493.PE530

AP009493.PE530       Location/Qualifiers
FT   CDS_pept        610540..611793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_530"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17359"
FT                   /db_xref="GOA:B1VRE1"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE1"
FT                   /protein_id="BAG17359.1"
FT                   /translation="MPAKRRLIVSCIAAAALSLLAGGGIAGQSPPGADSVDGAAPGAPR
FT                   AASSTAHGAYLDYGPAGVSRMAELSRWLGGAELRVGHTYLPGDLWVNIEGAPDFLDAWA
FT                   DWRQADPARMFVLNVPMLERNEERVPDAEVRTLLRAGAAGEYDQHFSRLAERLVELGVP
FT                   DTVIVLGWEMNGTTYTHRCGPDPASWKAYWQRIVTAMRAVPGQDFRFDFTPSRGRDAVP
FT                   WTECYPGDDVVDIIGMDSYDQPPGETFDDQVTDPYGLQKHVDFAAEHGKPISFPEWGLF
FT                   RNGDNPEYMRRMLEWIDRHKPLYQTVTDYCPHGVWQCKSNPRSSRVFRTMLTEMAAPAA
FT                   PTPSPAPTPTPTPPPTAAPTVPAPSPTVEPSVAPSPAPPAPTEPAAGAPTVREWCVPVP
FT                   FGDWLGPWLREREICFRY"
     atgccggcta agcgccgtct catcgtttcg tgcatcgcgg cggctgctct cagcctcctg        60
     gcgggtggcg gtatcgcggg tcagtcgcca ccgggcgccg attccgtcga cggcgcggcc       120
     cccggggcgc cgagggccgc gagcagcacg gcgcacggcg cgtatctgga ctacgggccc       180
     gccggggtca gcaggatggc cgagctgtcg cgctggctgg gcggggcgga gctgcgggtg       240
     gggcacacgt acctgccggg cgatctgtgg gtgaacatcg agggggcgcc cgacttcctc       300
     gacgcctggg ccgactggag acaggcggac ccggcacgga tgttcgtcct gaacgtgccg       360
     atgctggagc gcaacgagga gcgggtcccg gacgccgagg tccgcaccct gctgcgggcg       420
     ggcgcggccg gggagtacga ccagcacttc agccggctcg cggagcggct ggtggagctg       480
     ggtgttccgg acaccgtgat cgtgctcggg tgggagatga acggcaccac gtacacccat       540
     cggtgcggcc ccgatcccgc gtcgtggaag gcctactggc agcggatcgt cacggcgatg       600
     cgcgcggtgc ccggccagga cttccgcttc gacttcacgc cgagccgggg ccgggacgcc       660
     gtgccgtgga ccgagtgcta cccgggcgac gacgtcgtcg acatcatcgg gatggactcc       720
     tacgaccagc cgcccggcga gaccttcgac gaccaggtca ccgacccgta cgggctccag       780
     aagcacgtcg acttcgccgc ggagcacggc aagcccatct cgttcccgga gtgggggctg       840
     ttccgcaacg gcgacaaccc ggagtacatg cgacggatgc tggagtggat cgaccggcac       900
     aagccgctgt accagacggt gacggactac tgcccgcacg gcgtctggca gtgcaagagc       960
     aatccgcggt cctccagggt gttccggacg atgctgaccg agatggccgc gccggccgcg      1020
     cccacgccca gcccggcacc gactcccacc cccactcctc cccccaccgc agcgccgacg      1080
     gttccggcgc cctccccgac ggtcgagccg tccgtggcgc cttccccggc gccgccggca      1140
     cccacggagc cggcggccgg ggcgccgacc gtccgtgagt ggtgcgtgcc ggtcccgttc      1200
     ggcgactggc tgggcccgtg gctgcgggag cgcgagatct gcttccgtta ctga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page