(data stored in ACNUC7421 zone)

EMBL: AP009493.PE531

AP009493.PE531       Location/Qualifiers
FT   CDS_pept        612010..614475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_531"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17360"
FT                   /db_xref="GOA:B1VRE2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE2"
FT                   /protein_id="BAG17360.1"
FT                   /translation="MASADEGSPAEPGPLPSGDGREPVRTTDGAAAVIAGDGTVIGWTR
FT                   GAEALLGYPAAEVVGRSASQLLAGPPDARRTAAVAARCRAGSGWSGLVPLRARDGRSLD
FT                   IDVRVTASFLIAGREGFLVSGRELTPHWTMRGSVLDDFLTRSPVGMAVLDPELRYLWLN
FT                   DTLERFGGVPREQRLGRRPGDVLPEALAAPIERLMRQVLSTGEAITDYEYLGWSWADPH
FT                   RRRAYASSFFPLADARDRRIGVGYMVLDVTDRWNARRLLSLVNEAGASIGSTLDVQRTA
FT                   QELADFAVPRFADFVFVDLLENPFGGDRRGAVAPAEGERPAMRRAGMSSVREGCPEAVV
FT                   RVGETVDFVPPPHDAHFLLDGDPVLLPALDPDSHGWTVEQPARAARLREFGLHSLISVP
FT                   MRARDTVLGLTTFMRSRNPVPFDEDDVAPARELVARAAVCVDNARRYTREHTAALVLQR
FT                   SLLPHTLRGGTALDVASSYLPADAKDGVGGDWFDVIPLSGARVGLVIGDVVGHGIGAAA
FT                   TMGRLRTAVQTLADMDLPPDELLARLDDLVLRLSEEEGAGGPAERGGTTVVGATCLYAV
FT                   YDPSNGCCTMARAGHPPPVIVTPDDGVHFPDLPSGPPLGLGGLPFEALEIELPEGSLLG
FT                   LYTDGLIEGADKDLERGMERLGRALSRAGVPLDELCPAVVGELVPVPQPDDIAFLLART
FT                   HRLSPEHLVSWDVPVDPAAVGETRAKVSRRLEAWGLAELSMTTELIVSELVTNAIRYGE
FT                   GPVRLRLLFQSALTCEVSDASNTSPRLRHARTTDEGGRGLFLVAQLAHRWGTRYTPRGK
FT                   IIWAEQPLP"
     atggcatccg ccgacgaggg ctccccggcg gagcccggcc cgctgccctc cggggacggg        60
     cgggaaccgg tgcggacgac cgacggtgcc gcggcggtga tcgccgggga cggcacggtc       120
     atcggctgga cccgcggggc cgaggcactg ctcgggtatc cggcggccga ggtggtcggc       180
     cggtccgcct cccagctgct cgcggggccc ccggacgccc ggcgcacggc cgcggtggcc       240
     gcccgctgcc gggccggttc ggggtggagc gggctggtcc ccctgcgggc ccgggacggc       300
     cggtcgctgg acatcgacgt acgggtcacc gcctcgttcc tgatcgccgg gcgggagggc       360
     ttcctggtgt ccgggcggga gctcaccccg cactggacga tgcgcgggtc cgtgctggac       420
     gacttcctga cccggtcgcc ggtgggaatg gcggtgctcg atcccgagct gcgctatctc       480
     tggctgaacg acaccctgga acggttcggc ggcgtgcccc gggagcagcg tctggggcgg       540
     cggccgggcg acgtgctgcc cgaggcgctg gcggcgccca tcgagcggct gatgcggcag       600
     gtcctgtcga ccggcgaggc gatcacggac tacgagtacc tgggctggag ctgggccgat       660
     ccgcaccgcc gccgggcgta cgccagctcg ttcttcccgc tcgccgacgc ccgcgaccgg       720
     cggatcggcg tcggctacat ggtcctcgac gtcaccgacc ggtggaacgc gcgtcggctg       780
     ctctcgctgg tgaacgaggc cggggcgagc atcggcagca ccttggacgt acagcgcacg       840
     gcgcaggaac tcgccgactt cgcggtgccc cggttcgccg acttcgtctt cgtcgacctg       900
     ctggagaacc cgttcggcgg cgaccggcgg ggggcggtgg cgcccgccga gggcgagcgg       960
     ccggccatgc gccgggcggg catgagctcg gtgcgggagg gctgcccgga agcggtcgta      1020
     cgggtcgggg agacggtcga cttcgtcccg ccgccgcacg acgcgcactt cctcctcgac      1080
     ggcgacccgg tcctgctccc ggcgctcgac ccggacagcc acgggtggac ggtggagcag      1140
     ccggcacggg ccgcccggct cagggagttc gggctgcact cgttgatctc cgtgccgatg      1200
     cgggcgcgcg acaccgtgct ggggctgacc accttcatgc ggtcgcggaa tccggtgccg      1260
     ttcgacgagg acgacgtggc gcccgccagg gagctggtgg cgcgcgcggc cgtgtgcgtg      1320
     gacaacgccc gccgctacac ccgggagcac accgcggcgc tggtgctcca gcggagcctg      1380
     ctgccgcaca cgctgcgcgg tgggacggcg ctggacgtgg cgtcgtcgta ccttccggcg      1440
     gacgccaagg acggggtggg cggcgactgg ttcgacgtga tcccgctgtc cggggcccgg      1500
     gtgggcctgg tcatcggcga tgtcgtcggg cacggcatcg gggccgccgc gaccatggga      1560
     cggctgcgca ccgccgtgca gacgctggcc gacatggacc ttcccccgga cgagctgctg      1620
     gcccgcctgg acgatctggt cctgcggctc agcgaggagg agggcgcggg gggaccggcg      1680
     gagcggggcg ggacgacggt ggtgggggcc acctgtctgt acgccgtcta cgatccgtcg      1740
     aacggctgct gcacgatggc gcgggccggt cacccgccgc cggtgatcgt cacgccggac      1800
     gacggggtcc acttccccga cctgccctcg gggccgcccc tgggactcgg cgggctgccc      1860
     ttcgaggccc tggagatcga gctgcccgag ggaagcctcc tcggcctcta caccgacggg      1920
     ctcatcgagg gggccgacaa ggacctcgaa cgcggcatgg agcggctcgg ccgggcgctg      1980
     tcgcgggccg gggtgccgct ggacgagctg tgtccggccg tggtcgggga gctggtgccc      2040
     gtgccgcagc cggacgacat cgcgttcctc ctcgcccgga cgcaccgcct gagccccgag      2100
     cacctggtct cgtgggacgt gcccgtggac cccgcggcgg tcggcgagac ccgggcgaag      2160
     gtctcgcgcc ggctggaggc gtgggggctc gcggagctgt cgatgacgac ggagctgatc      2220
     gtgagcgaac tcgtgaccaa cgcgatccgg tacggcgagg ggccggtacg gctgcggctg      2280
     ctgttccagt cggcgctgac ctgcgaggtg tccgacgcca gcaacacctc gccgcggctg      2340
     cggcacgcca ggacgacgga cgagggcggg cgcgggctgt tcctggtcgc tcagctcgcc      2400
     catcgatggg gcacgcgcta caccccccgg gggaagatca tctgggcgga gcagcctctc      2460
     ccctga                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page