(data stored in ACNUC7421 zone)

EMBL: AP009493.PE534

AP009493.PE534       Location/Qualifiers
FT   CDS_pept        complement(618054..619571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_534"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17363"
FT                   /db_xref="GOA:B1VRE5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE5"
FT                   /protein_id="BAG17363.1"
FT                   /translation="MKERAAMPDTPERAAAPGREAGTVLPAAPDLLPEALADARSPRAP
FT                   ELSPYVPERPFPWNGPVTPYAGEPGTAIDLDRVLRLSLAAPAGTPGRLRPVPSAGALHP
FT                   VRAHLLLGSGCSLPPGRYVYDPRAHRAHRRGPAPDGIPPGALAVLTVAASRTVAHYGHR
FT                   AWPLLLLDTGHAAAALALAGATTADVLVSLDADGPLLSAAAGLPEAPEWQDVWPGTEPE
FT                   LPLAAVRLTHPGSPVEAGPPLSAWAARSRASAPTPQPGADATPPRGLAAARHLLHHIAA
FT                   VRGRPDGTWHPAPRTGEPTDQDLLTRRSAPPEDLNRPPEKELLSRILATAERVLPEGPA
FT                   WTVALGGATPGLYAAAPGRPGLAVRAVGDARPTLAHWAAGQHWIGTAGAVLLAHGCPED
FT                   APRATVRSSHLAAGYAVGAAQAHATALGLRSRPIGSWQQADLGAALGGTPGREWIVHGL
FT                   ALGAPPTTAATPATTAATAAATSAPAATTPPTASAAPATPPGEEERP"
     gtgaaggagc gcgccgccat gcccgatacg ccggagcgag ccgccgcgcc cggtcgcgag        60
     gcgggtaccg tcctgcccgc cgcaccggac ctcctgcccg aggcgctcgc ggacgcccgg       120
     tcgccgcgtg ctccggagct ctccccgtac gttccggagc gcccgttccc gtggaacggc       180
     cccgtaactc cctacgccgg cgagcccggg accgcgatcg acctggaccg tgtgctgcgg       240
     ctctcgctgg ccgcgcccgc aggcacaccg ggccggctgc gtcccgtccc ctcggcgggt       300
     gctctgcacc cggtgcgcgc ccatctgctg ctcggctcgg gatgttcgct gccgcccgga       360
     cgttacgtct acgacccgcg cgcccaccgc gcccaccggc gcggtccggc ccccgacggt       420
     atacccccgg gagctctcgc cgtcctcacc gtggccgcgt cccgtaccgt cgcccactac       480
     ggccaccggg cctggccgct gctgctcctc gacacggggc atgccgccgc cgccctcgcg       540
     ctggccgggg ccacgaccgc cgacgtgctg gtctccctcg acgcggacgg ccccctcctg       600
     tccgccgcgg ccggactccc cgaggccccg gagtggcagg acgtctggcc cggcaccgag       660
     ccggaactac cgctcgcggc cgtacggttg acgcatccgg gcagtcccgt cgaagccgga       720
     ccgccgctga gcgcctgggc tgctcggtcc cgcgcctcag ccccgacgcc acaacccggc       780
     gccgatgcca ccccgccccg tggactcgcc gcggcacggc acctgttgca ccacatcgcc       840
     gcagtgcgtg ggcgacccga cggcacctgg cacccggccc cgcgcaccgg agagccgacc       900
     gaccaggatc tcctgacgcg ccggagcgcc ccgcccgagg acctgaaccg gccgcccgag       960
     aaggagctgc tgtctcggat cctggccacc gcggagaggg tgctgccgga ggggcccgcc      1020
     tggaccgtgg ccctgggcgg cgccaccccg ggcctgtacg ccgcggctcc cggcaggccg      1080
     ggcctcgccg tccgcgccgt gggcgacgcg cgtcccaccc tcgcccactg ggccgcgggc      1140
     cagcactgga tcggtaccgc aggcgcggtg ctcctggccc acgggtgccc cgaggacgcc      1200
     ccccgggcca ccgtccgcag cagccacctc gccgccggat acgcggtcgg cgcggcccag      1260
     gcgcacgcca ccgcactggg cctgcgctcg cgccccatcg gctcctggca acaggccgac      1320
     ctgggcgcgg ccctcggcgg cacccctgga cgcgaatgga tcgtgcacgg cctggccctc      1380
     ggcgcacccc cgacgacagc agccacccca gccacgacag cggccacggc cgccgccact      1440
     tcagcccccg cagcgaccac cccacccacg gcatccgccg cccccgcgac cccgcccggc      1500
     gaggaagaac gcccatga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page