(data stored in ACNUC7421 zone)

EMBL: AP009493.PE535

AP009493.PE535       Location/Qualifiers
FT   CDS_pept        complement(619568..620935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_535"
FT                   /product="hypothetical protein of YcaO-like family"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_535"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17364"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE6"
FT                   /protein_id="BAG17364.1"
FT                   /translation="MTSLLPLEALVDPVSGIIRDVAPVEHPTGAPPRYTAMTADVADAR
FT                   RLGAWPADRVSLGTTFGDPRGAWIAAVAEAVERYCGNRLPPPGHPQEPRRATAAELTAE
FT                   GARVYGPGALPTYAPWQFGRPGFPYAELTPDTPALWTRAVENGEPCWAPVALTHLNWRQ
FT                   GELRSLPRTHHLNYAGIATGQGLDDAVERGLLEVVERDALELWWHLDGPTRGIDPAGVP
FT                   GLTEDLAGCGLDVHIVEMPSEFAPCVAALVHDPGRGLYAAGFACRYDPAEAARKAVLEA
FT                   VHTWVFTQGAVDADGWVYRAIEAGMLARGLYLDHRADRRYLDDCGPGFAAVRDLGAHVQ
FT                   VWLDDRMAPLARRFTEPALGVVPVTAITPGSRAALDAALAAGDHRVITVDLTTEDVAET
FT                   PLRVARVLVSGLIPNAPAAFGYFGCPRLAEAALARGWRTRPPTAPGDFTLAPPPHM"
     ttgaccagcc tcctgcccct cgaagccctc gtcgaccccg tcagcgggat catccgcgac        60
     gtcgcacccg tcgagcaccc caccggggcg ccgccccgct acaccgcgat gaccgccgac       120
     gtcgccgacg cccgccgcct cggcgcctgg cccgccgacc gggtctcgct cggcaccacg       180
     ttcggcgacc cccggggcgc ctggatcgcc gccgtcgccg aggccgtgga gcgctactgc       240
     ggcaaccgcc tcccgccgcc cggccacccc caggagcccc ggcgtgccac cgccgccgag       300
     ctgaccgccg agggagcccg cgtctacggc cccggtgcgc tgccgaccta cgcgccgtgg       360
     cagttcggcc gcccgggctt cccgtacgcc gaactcaccc ccgacacacc ggcgctgtgg       420
     acccgggccg tcgagaacgg ggaaccctgc tgggcccccg tcgccctgac ccacctcaac       480
     tggcgccagg gagagctgcg ttcgctgccc cgcacccacc acctcaacta cgcgggcatc       540
     gccaccgggc agggactcga cgacgccgtc gagcgcgggc tcctggaagt cgtcgagcgc       600
     gacgccctgg agctgtggtg gcacctggac gggcccaccc ggggcatcga cccggccggc       660
     gtccccgggc tcaccgagga tctggccggc tgcgggctgg acgtgcacat cgtggagatg       720
     ccctccgagt tcgccccctg cgtcgccgcc ctcgtgcacg atcccgggcg cggtctgtac       780
     gcggccgggt tcgcctgccg gtacgacccg gcggaggcgg cccgcaaggc cgttctggag       840
     gccgtgcaca cctgggtgtt cacacaaggc gcggtggatg cggacgggtg ggtgtaccgg       900
     gcgatcgagg ccgggatgct cgcccgtggc ctctacctcg accaccgggc cgaccggcgt       960
     tatctcgacg actgcgggcc cgggttcgcc gccgtccggg acctgggcgc ccatgtccag      1020
     gtctggctgg acgaccggat ggccccgctc gcccgccgct tcaccgaacc cgccctgggg      1080
     gtggtcccgg tcaccgcgat cactcccggc agccgcgccg cgctcgacgc ggcactcgcc      1140
     gccggggacc accgggtcat caccgtggac ctcaccacgg aggacgtcgc cgagacgccg      1200
     ctgcgcgtcg cccgcgtcct ggtctccgga ctgatcccca acgcacccgc tgccttcggc      1260
     tacttcggct gcccccgcct cgcggaggcg gcgctcgccc ggggctggcg cacccgaccg      1320
     cccaccgccc cgggggactt caccctcgcc ccgcccccgc acatgtga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page