(data stored in ACNUC7421 zone)

EMBL: AP009493.PE537

AP009493.PE537       Location/Qualifiers
FT   CDS_pept        complement(622557..623486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_537"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17366"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRE8"
FT                   /protein_id="BAG17366.1"
FT                   /translation="MLRTSGGEFLRVDTGGVTGEALVRRLAGQEEAPDEGGNAAELDRL
FT                   VQAFEAAGYAVSAPPRAPLAGRTVHVLGDPVLAEPLARCAGAEGAEVHRITPDRVAELV
FT                   RAAPDPRVVGRVAVVWCLDSPVPEGLWDAADLLPGRRVAWLRCHREGAHSWTEPLAATP
FT                   GDVTSRHVRLRRLAATPAHRELAAYWAGHRTPDTGPHPTEASAALIAALLTADLLAWAE
FT                   AEAEAEVEERAGAGAGARIEAGAEPEAGARAAAEPGARVLPVRRRLRRIDLRALTFTEH
FT                   PVLPVPDVAPLPAPAPARAGTGVAGARP"
     gtgctccgga cctccggagg ggagttcctg cgcgtcgaca ccggcggtgt caccggcgaa        60
     gccctggtgc gccggctggc ggggcaggag gaggcgccgg acgagggcgg gaacgccgcc       120
     gaactcgacc gtctcgtgca ggccttcgag gctgccgggt acgcggtgtc cgctccgccc       180
     cgggccccgc tcgccgggcg cacggtccat gtcctcggcg accccgtgct cgccgagccg       240
     ctggcgcgct gtgccggagc ggagggggcc gaggtccacc ggatcacccc ggaccgggtg       300
     gcggagctcg tccgggcggc cccggacccc cgcgtcgtag ggcgcgtcgc cgtggtgtgg       360
     tgtctcgact cacccgtgcc cgaagggctc tgggacgcgg cggacctgct gcccgggcga       420
     cgcgtcgcct ggctgcgctg ccaccgcgag ggcgcccaca gctggaccga acccctggcc       480
     gccaccccgg gagacgtcac ctcgcgtcac gtccggctcc gcagactcgc ggcgaccccc       540
     gcccatcgcg aactcgccgc gtactgggca gggcaccgga cccccgacac cggaccgcac       600
     cccaccgaag cctccgccgc cctgatcgcc gcgctcctca ccgccgatct cctcgcctgg       660
     gccgaagccg aagccgaagc cgaagtcgag gaacgggccg gagccggagc cggggcgcgg       720
     atcgaagccg gggcagagcc ggaggccggg gcgcgggccg ccgccgagcc cggggcgcgc       780
     gttctcccgg tgcgccgtcg gctgcgccgg atcgacctgc gcgctctcac cttcaccgag       840
     caccccgtgc tccccgtccc ggacgtcgca cccctgcccg ccccggcccc cgcgcgcgcc       900
     gggaccggag ttgccggggc gcgcccgtga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page