(data stored in ACNUC7421 zone)

EMBL: AP009493.PE539

AP009493.PE539       Location/Qualifiers
FT   CDS_pept        complement(623910..624815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_539"
FT                   /product="putative ABC-type Fe3+-siderophore transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_539"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17368"
FT                   /db_xref="GOA:B1VRF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF0"
FT                   /protein_id="BAG17368.1"
FT                   /translation="MPEGLTGPVESSPVEEAGAEAEPGGAPGPEVVRAEGLTFGYPGRP
FT                   VLRGVDLSVRAGELVALIGLNGCGKSTLLKLAAGLLTPSGGRVLLEGDDVARLPRRAAA
FT                   RRVALLHQSAPAVPGLTVRQLVRQGRYAARGPLGMLREGDDEVTSRALADVGVTAWADR
FT                   PVDALSGGERQRVRLAMALAQDARLLFLDEPTTYLDLRHQLEVLRTVVRLRAERRLTVV
FT                   MVLHDLNHAARFADRIVALREGRVAADGPPAEVVTRRLLAEVLGVEGRVGIDSEGGWPV
FT                   CYPDHPLEPLQLLRNENHIH"
     atgccggaag gcctgaccgg accagtggag tcgagcccgg tggaggaggc cggagcggaa        60
     gcggaacccg gcggggcgcc cggtcccgag gtcgtacggg cggaggggct gacctttggc       120
     tacccgggcc ggccggtcct gcgcggggtg gacctgagcg tccgggccgg ggagttggtc       180
     gccctgatcg gactgaacgg ctgcggcaag agcaccctgc tcaagctcgc cgccggactg       240
     ctcaccccga gcggcgggcg cgttctgctg gaaggcgacg acgtggcccg gctgccccgc       300
     cgtgccgccg cccggcgcgt cgccctgctc caccagtcgg cccccgccgt tccgggactg       360
     acggtgcggc aactcgtgcg acaggggcgc tatgccgccc gggggccgct cgggatgttg       420
     cgggagggcg acgacgaggt gacgtcgcgg gcgctcgcgg acgtcggcgt caccgcctgg       480
     gccgaccggc ccgtggacgc cctgtccggg ggtgaacgcc agcgggtccg gctggccatg       540
     gcgctggccc aggacgcccg cctgctcttt ctcgacgagc cgaccaccta tctcgatctg       600
     cggcaccaac tggaggtgct ccggacggtc gtacggctgc gcgcggaacg ccggctgacg       660
     gtggtgatgg tgctgcacga cctcaaccac gccgcgcggt tcgccgatcg gatcgtcgcg       720
     ctgcgcgagg gccgcgtggc cgccgacggg cctccggccg aggtggtcac ccggcgtctg       780
     ctggccgaag tcctcggtgt ggagggccgg gtggggatcg acagtgaggg cggctggccc       840
     gtctgttacc cagatcaccc tctcgaaccg ctccagctat tgcggaatga aaatcatatt       900
     cattag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page