(data stored in ACNUC7421 zone)

EMBL: AP009493.PE540

AP009493.PE540       Location/Qualifiers
FT   CDS_pept        complement(624901..625959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_540"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17369"
FT                   /db_xref="GOA:B1VRF1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF1"
FT                   /protein_id="BAG17369.1"
FT                   /translation="MTLTDTVPGPSRRFPRAPGVRMGGLALLVAAVACADLLAGRGVTP
FT                   DGARAVLLGHGDDPTAQHIVLHLRLPRMLVALVAGACLGVAGLVLQSALRNPLAGPEVT
FT                   GVTPGAVLGAVTATGLGLAGWESPTAVVVAACLGGFAGAGLLWLLAGRDRGDPEQTAVY
FT                   GVLVSAVLAGLTAVVLLVAPGELGSVVQWLIGSTEGRVWQHWELLWPWAAFWGAAAWLL
FT                   AGPLTLLRCGDEQASAAGLATGRGRGAALVCAVALTAGAVSAVGALGFVGLLVPHLALA
FT                   VFGADLRITLPGAALLGAAVVCGADAAAQWLSPLLATALDADRLTLPVGALTTCVGAGL
FT                   LMVVARRRADER"
     atgacgctca ccgacaccgt gcccggaccg tcgcgtcggt tcccgcgcgc gccgggcgtc        60
     cggatgggcg gcctggcgct gctcgtcgcc gcggtggcct gcgccgatct cctcgccggc       120
     cggggcgtca cccccgacgg cgcccgggcc gtgctgctcg gccacggcga cgaccccacc       180
     gcccagcaca tcgtgctcca tctgcgactg ccccggatgc tggtggcgct ggtcgccgga       240
     gcgtgtctcg gagtggccgg gctggtgctc cagtcggccc tgcgcaaccc gctggccggg       300
     cccgaggtca ccggcgtcac ccccggtgcg gtgctcggcg cggtcaccgc gaccggcctc       360
     ggcctcgcgg gctgggagtc ccccacggcc gtcgtcgtgg cggcctgcct cggcggtttc       420
     gccggggcgg ggctgctgtg gctgctcgcc gggcgggacc ggggcgaccc ggaacagacg       480
     gccgtgtacg gggtcctcgt gtcggcggtg ctcgccgggc tcaccgcggt cgttctcctg       540
     gtggcccccg gcgagctcgg cagcgtcgtc cagtggctga tcgggtccac cgagggccgg       600
     gtgtggcagc actgggagct gctctggccg tgggccgcct tctggggcgc cgccgcctgg       660
     ctgctcgccg ggccgctgac cctgttgcgc tgcggcgacg aacaggcctc cgcggcgggc       720
     ctggccaccg gtcggggccg gggggcggcg ctcgtctgcg ccgtggcgct gacggccggt       780
     gccgtatcgg ccgtgggggc gctcggcttc gtggggctgc tggtgcccca cctggcgctg       840
     gccgtcttcg gggccgacct gcgcatcacc cttccggggg cggcgctgct cggcgcggcg       900
     gtggtgtgcg gggcggacgc cgccgcccag tggctgtcac cgctgctggc caccgcgctc       960
     gacgcggacc ggctgaccct cccggtcggc gccctgacca cctgcgtggg ggcggggctg      1020
     ctgatggtcg tggcgcggcg gcgggcggac gagcgatga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page