(data stored in ACNUC7421 zone)

EMBL: AP009493.PE541

AP009493.PE541       Location/Qualifiers
FT   CDS_pept        complement(625956..627017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_541"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_541"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17370"
FT                   /db_xref="GOA:B1VRF2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF2"
FT                   /protein_id="BAG17370.1"
FT                   /translation="MRRPPVVPLCLGAVALAGAVCALSLGTPYVPPAALPAALGSDGLA
FT                   GLVVTELRLPRMVLALIAGACLGAAGLVLQEALRNPLAVPEMLGVSSGAALGVAAPLVL
FT                   ALAVPLGLQPFLALAGAALGGLLTLVAAGFGRSPSAVLLTGAAVAAALQAALLVLMVMA
FT                   DQLDLQLIYRYLLGSLSARTWDDVTGLLPWLAAAVPALVLCVPVLGVLRLGDDDARALG
FT                   VRVERARVAALGIAVVLIAPVVAVCGPVAWVGFLAPHLARRLRPDGGAAGWLVRSAGCG
FT                   AIVVLCADQPARLALAPVETPVGAWTALVGVPVGVLLLKRGRRPARVRRPLPPSLPQAP
FT                   TALAAPVLRKAER"
     gtgaggcgcc cgcccgtcgt gccgctctgc ctgggcgcgg tggccctggc gggcgcggtc        60
     tgcgcgctca gtctcggcac cccgtacgtc ccgcccgccg cgctcccggc cgcactgggg       120
     tccgacgggc tcgcggggct cgtcgtcacc gaactgcggc tgccccgcat ggtgctggcg       180
     ctgatcgccg gggcctgcct gggggccgcg ggcctcgttc tccaggaggc cctgcgcaac       240
     ccgctcgccg tgcccgagat gctgggcgtc tcctccgggg ccgccctggg cgtcgccgca       300
     ccgctggtcc tggccctggc cgtgcctctc ggactgcaac cgttcctggc cctggccggg       360
     gcggcgctcg gcggcctgct caccctggtc gccgccggat tcgggcggag cccctcggcc       420
     gtcctgctga ccggtgccgc cgtcgccgcc gcactccagg ccgccctgct ggtgctcatg       480
     gtgatggccg accagctcga cctccagctc atctaccgct atctgctggg cagcctgtcg       540
     gcccgcacct gggacgacgt caccggactg ctgccctggc tcgccgcggc cgtcccggcg       600
     ctggtgctgt gcgtaccggt gctcggtgtg ctgcgcctcg gcgacgacga cgcccgcgcg       660
     ctgggcgtac gggtcgaacg cgcgcgggtc gccgcgctgg gcatcgccgt cgtcctcatc       720
     gcccccgtcg tcgcggtctg cggaccggtg gcctgggtcg gcttcctcgc tccccacctc       780
     gcccgccggc tccgccccga cggcggcgcg gccgggtggc tcgtccggtc cgccgggtgc       840
     ggcgcgatcg tcgtgctgtg cgcggaccag ccggcccggc tggcgctcgc ccccgtggag       900
     acgcccgtcg gcgcctggac cgccctggtc ggggtgcccg tcggggtcct cctgctgaag       960
     cgggggaggc ggcccgcccg ggtccggcgg cccctgccgc cgtccctgcc gcaggcccct      1020
     acggctcttg ccgctcccgt cctgcggaag gcggaacgat ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page