(data stored in ACNUC7421 zone)

EMBL: AP009493.PE542

AP009493.PE542       Location/Qualifiers
FT   CDS_pept        complement(627014..627853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_542"
FT                   /product="putative ABC-type Fe3+-siderophore transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_542"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17371"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF3"
FT                   /protein_id="BAG17371.1"
FT                   /translation="MRPIEAATRITDAEGVTVSLPKPPERIVCLVALCDDMLVELGMTP
FT                   TATNSRVLAHPKFLGEEKAAGIPVVPGGFLSPEVEAVLAHRPDLVIGLEDTHGKLAPAL
FT                   KGATTFWPVQPGSWQDSVGYLRNLAALTGRTEQGERAERGFRTRLARAERSASDRTALI
FT                   VYGSDENFGVATPETDVAAGLFPKISHYPWKSRGVEGSYSLEEILARDVDVLFVETLSF
FT                   GAPDGRLSDKLAQNPLWSRIPAVKNGKVIEVDSEVWAKGRGTRSLGVVLDEATAALR"
     gtgcggccca tcgaggccgc cacccggatc accgacgccg agggcgtcac ggtctccctg        60
     ccgaagccgc cggagaggat cgtctgcctg gtggccctct gcgacgacat gctcgtcgag       120
     ctggggatga ccccgaccgc caccaactcc cgggtgctgg cgcacccgaa gttcctgggc       180
     gaggagaagg ccgcggggat acccgtcgtg cccggcggct tcctcagccc cgaggtcgag       240
     gccgtcctgg cccaccggcc cgacctggtg atcggcctgg aggacacgca cggcaagctg       300
     gcccccgcgc tgaagggcgc cacgacgttc tggcccgtcc agcccggatc ctggcaggac       360
     agcgtcggct acctgcgaaa cctggcagcg ctcaccggcc gcaccgagca gggcgagagg       420
     gcggagaggg gcttccgcac ccgcctggca cgggcggagc gcagtgcgag cgacaggacc       480
     gcgctcatcg tctacggcag cgacgagaac ttcggcgtgg ccaccccgga gaccgacgtg       540
     gcggccggac tgttcccgaa gatctcccac tacccctgga agagccgggg cgtggagggc       600
     agttacagcc tggaggagat cctcgcccgg gacgtcgacg tcctcttcgt ggagacgctc       660
     tccttcggcg caccggacgg caggctctcc gacaagctgg cgcagaaccc gctctggtca       720
     cgcatccccg ccgtgaagaa cggcaaggtc atcgaggtcg actccgaggt gtgggccaag       780
     gggcgcggca cccgttccct gggcgtcgtc ctcgacgagg cgacggccgc actgcggtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page