(data stored in ACNUC7421 zone)

EMBL: AP009493.PE543

AP009493.PE543       Location/Qualifiers
FT   CDS_pept        628200..629480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_543"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17372"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF4"
FT                   /protein_id="BAG17372.1"
FT                   /translation="MPQSPHPSPHAPPRLLVSDHVAGRISLLDLPDGTERAELRHRHLA
FT                   EHAGFLALPDGLTACVDDRAGELLVLDPYGPGAGHPFVRRRIPVAVPAEHLAADPRGRH
FT                   LAVTTGLGRNEEAWTGLLTAVDLDAPDGAVAVRVRGRTGEPGVTVLGGGPSPLVVLRHR
FT                   EPGELLAHRHRDLMRSAPACPPAAPVGRIALPDDDGHGDAHDPLTRRVFAAAGSGVHRA
FT                   RREGDGLVGETPLPWSADGRSGGRGHYLRLDPVRRMLWSCVRGGPGDPGQWPTWSNDAW
FT                   WHQLDTGVTGRLDLGPGLVFRLAVTARHIAYTRVHPDGDELVLLTAPPVAGSRPEIAAR
FT                   LPLPAMSGAPRPGGTPWDGVQRRAVAASPGGGLVAVSRGGHGEVHVFDADRADLLTTLT
FT                   VPTPLDDGGHLALLTPGDGAEADPVGR"
     gtgccacagt ccccgcaccc ttcgccccac gcaccgccgc gcctgctggt ctccgaccat        60
     gtcgccggtc ggatcagcct gttggacctc ccggacggca cggagcgcgc cgaactgcgc       120
     caccggcacc tcgccgagca cgccggtttc ctcgccctgc cggacggcct caccgcctgc       180
     gtggacgacc gggcgggcga gctgctggtc ctggacccct acggccccgg cgccggacat       240
     ccgttcgtcc ggcgccggat accggtcgcg gtccccgccg aacacctggc ggcggacccg       300
     aggggccggc acctcgcggt gaccaccggc ctcgggcgca acgaggaggc ctggaccgga       360
     ctcctgacgg ccgtcgacct cgacgccccg gacggcgccg tcgccgtacg cgtgcggggg       420
     cggacgggcg agccgggagt cacggtcctc ggcggcgggc cgtccccgct cgtggtgctg       480
     cgccaccggg agccgggcga actgctggcc caccggcacc gcgacctgat gcgttcggcc       540
     ccggcctgcc ctccggcggc tcccgtcggg cggatcgccc tgccggacga cgacggccac       600
     ggcgacgccc acgaccccct cacccgccgg gtgttcgccg ccgcggggtc gggggtgcat       660
     cgcgcacggc gggaggggga cggcctcgtc ggcgagaccc ccctgccctg gtccgccgac       720
     gggcgctccg gcgggcgcgg tcactacctg cggctcgacc ccgtgcggcg gatgctctgg       780
     tcctgcgtgc gcggcggacc cggcgacccc gggcagtggc ccacgtggtc caacgacgcc       840
     tggtggcacc aactcgacac gggcgtcacg ggccggctgg acctgggccc cggactggtc       900
     ttccgactcg cggtgaccgc ccgccacatc gcctacaccc gcgtccaccc ggacggcgac       960
     gaactggtcc tgctcaccgc gcccccggtc gccgggtccc gtccggagat cgccgcacgc      1020
     ctgcccctgc ccgccatgtc cggcgcaccc cggcccggcg ggaccccctg ggacggcgtg      1080
     cagcgcaggg ccgtcgccgc ctcccccggc ggcggcctgg tggcggtcag ccggggaggc      1140
     cacggcgagg tccacgtctt cgacgcggac cgggcggacc tcctcacgac cctgaccgtc      1200
     ccgacacccc tggacgacgg cggccacctc gccctcctca cccccgggga cggggcggag      1260
     gccgacccgg tcggccgctg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page