(data stored in ACNUC7421 zone)

EMBL: AP009493.PE544

AP009493.PE544       Location/Qualifiers
FT   CDS_pept        complement(629544..629849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_544"
FT                   /product="putative 30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_544"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17373"
FT                   /db_xref="GOA:B1VRF5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VRF5"
FT                   /protein_id="BAG17373.1"
FT                   /translation="MAKKSKIARNDRRRETVERYAARRAELKEVIRRPGTPEPERNRAV
FT                   EELRRQPRDASATRVRNRDSVDGRPRGYLRRFGLSRVRMREQAHAGFLPGVTTSSW"
     atggcgaaga agagcaagat cgcgcggaac gacaggcgcc gggagaccgt cgagcgctac        60
     gccgcccgca gggccgagct gaaggaggtc atccgccgcc ccggtacgcc ggagcccgaa       120
     cggaaccggg ccgtcgagga gttgcggcgg cagccccgtg atgccagtgc cacccgggtg       180
     cgcaaccgcg acagcgtcga cggcaggccc cgggggtatc tgcgcaggtt cggactctcc       240
     cgggtccgga tgcgtgagca ggcccacgcc gggttcctcc cgggggtgac cacgtcctcc       300
     tggtga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page