(data stored in ACNUC7421 zone)

EMBL: AP009493.PE545

AP009493.PE545       Location/Qualifiers
FT   CDS_pept        complement(629849..630085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_545"
FT                   /product="putative 50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_545"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17374"
FT                   /db_xref="GOA:B1VRF6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRF6"
FT                   /protein_id="BAG17374.1"
FT                   /translation="MSAHCQLTGSKPGFGNNISHSHRRTSRRFDPNVQRKRYWLPGEGR
FT                   SVRLTLSARAIRTVDSIGIEAAVARIRARGGKV"
     atgtccgccc actgccaact gaccggctcg aagccgggat tcggcaacaa catctcccac        60
     tcgcaccgcc gcacgtcccg acggttcgac ccgaacgtgc agcgcaagcg gtactggctg       120
     cccggcgagg gccgctctgt gcgcctcacg ctgagcgccc gggccatcag gaccgtcgac       180
     agcatcggca tcgaggccgc ggtcgcgcgc atccgtgcgc ggggaggcaa ggtctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page