(data stored in ACNUC7421 zone)

EMBL: AP009493.PE546

AP009493.PE546       Location/Qualifiers
FT   CDS_pept        630154..630318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_546"
FT                   /product="putative 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_546"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17375"
FT                   /db_xref="GOA:B1VRF7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VRF7"
FT                   /protein_id="BAG17375.1"
FT                   /translation="MARNEVRPVIKLRSTAGTGYTYVTRKNRRNDPDRMVLRKYDPVAR
FT                   RHVDFREER"
     atggctcgca acgaagtacg cccggtcatc aagctccgct ccaccgcggg gaccggttac        60
     acctatgtca cccgcaagaa ccggcggaac gaccccgacc ggatggtgct gcgcaagtac       120
     gacccggtcg cccgccgcca cgtcgacttc cgcgaggagc gctga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page